Identifiers and Description

Gene Model Identifier

Contig14607.0.g95

Standard Name

SMARCD1b

Aliases

Contig14607_0_g95

Description

SWIB/MDM2 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009255609.99946582325553e-18SWIB/MDM2 domain containing pr
otein
SGDYMR233W0.0000009995106777214876TRI1 SGDID:S000004846, Chr XII
I from 739185-739865, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14607.0.g95(coding)
ATGGAAGGCGGCGACAACAATAATCAACACTAAGAACTAAATCACTAAGAGGAGATTGAA
GTATAAATTGACACCTCAACTAACCAATAAAACGTTGGCAATCATGGTTTAGAGTTGACA
GCTAACCATCATGAATAGGATCAATTATTGAATGGTCATTAAGATCACTATGATGATGAG
GATCAAAAGGAGGGAAATGCTGGCAATGATGATGGTGATAACTAAGATAATAATCACCAA
CAACAGCATCATAAAGAAGATTTAACAATGGAGTAATAGTAGTAGAGAGACTAATAGCAG
CAACAACAGTAAGCTGGAAGAGTGCAAAGAAAGAACAGAGAACTCTCTTACATGAAGGCT
TAGAACATCATTCATGATGACCTCAACAACTAGAAGCAGTATAAGCAAGGCTCCTTCAAT
AAAGCCCAACAAGCTAAAGTACACAATTTCTTTGCGAAACAGAAGCAAGAAAGAGCCCTA
GATTTCAAGTAAATGCGCAAGAACCTAGATTCACTCCGTATGCCAATAGACATCGAATAT
CTACTGCCAAATAAAGTGAGAGTATATGAGTAGATGAGGGAACTAGATGAGCAGATGAAC
TCATTTATCAAGTCTAAGCTGCTCAGTGTGAAGGAAGACTTGCTGCAGAACAATCAACCT
AAGGGGGTCAAGAGAAACCTCAGGATCATGATTGAAGTTTCACATGTTAATCCAACTGCT
TAGATGACTGGCAGTGAGTGGAAGATCAGGATTGAAGGCAGATTGATGGGAAATGAATCA
GAGTAAGATCAACTTCTAACAGGGAAACCTGAAGATGACGCCAGACTTTGCAAAAGATTC
CTTAGCTTCTTCGATCGTGTAAGAGTTGAGTTTCCCTAAGAGGAGTACCCTCACGTGGAT
TGGTCCAAGGCAAAGAGTGATGCAGGTGCAAACTTCGATTGCATTGAAATTGTTAGAGCT
TTCCCCAAAGATTACAAGAGAAAGTAGCAATCTATTCCAATCAAACTCATCTTTTCTGTT
GAAAACAACCCTAAGAAGTACAGGCTTTCTCCACAATTGACTAAGATACTTGGCATGGAA
GAAGAAACTAGGTTAAGAATTATTGGCGCACTTTGGTAATACATTAAATCAAACAGACTT
TAAGACTCAGACAATAGAGAATTGGTTAATTGCAACGCAGAGCTCCTTGAAATATTTGGT
GATGATAAAGTTGAATTTCACAATGCCATCTTTAAGCTGAAAGACCATTTGTTTGAAGTC
TAACCTATAGAGCTTAACTTTGAGATCAAGACCACAAGAGGCACACCCCAGGTAGTTTAT
CATTTCTATGACATGTCAGTGTTTGAGTATCACACTGAATCACAAAAAGAGCAGATTGAA
TTCTTGATTAATTGCAACTACGATTTCTTTAATTCAAATCAGAATCCCAGTGCAGACTAA
ACATCTGGTTCATCAACTTCTAAGCTAGCATTGAATGGCAACTTACTGAAAAAGAGAGAA
CTGAAGTAAAACATCAAAATCTCCAATTCCATTGAGAAACTAAAGAAAGCCTATCGTCAT
ATGGATTTCTTCAATAAGATGTCTGGAGATGTTAAAACTTAACTCTCAAATGTGATTATC
GAGTAAAATAAGTGGCTTAAAGTCATTCAGGAAGAGCAGACTCCATTCTATGACTACGCT
GGAGAGCAGGATCATGCAGTGTTCTATCAGTAGAATTAGAATTGGATTATGAGTGAAGTC
GAGAGCTATATTGAGCAGTAGTAAATCCACCTTGAGAAACAAAAGAAAGCCCTTGCTGAT
CAACAGAGTAAGAATGACAGCAGCCATGCAAGCAGAGCAGACCAACAAGATAACTAAAAT
GAATAAAGCGAGAGAAAAAGTGCAAATGGTGCAGCAGGAAGTAACATGGGTCTAGGAGCT
GCAATCAAGCCATTCAGCAGTGCAAATATTGGTGGCAGTGGCACTAGTAGAAGCGGAGCA
TATTCCCTCAGATGA


>Contig14607.0.g95(protein)
MEGGDNNNQHQELNHQEEIEVQIDTSTNQQNVGNHGLELTANHHEQDQLLNGHQDHYDDE
DQKEGNAGNDDGDNQDNNHQQQHHKEDLTMEQQQQRDQQQQQQQAGRVQRKNRELSYMKA
QNIIHDDLNNQKQYKQGSFNKAQQAKVHNFFAKQKQERALDFKQMRKNLDSLRMPIDIEY
LLPNKVRVYEQMRELDEQMNSFIKSKLLSVKEDLLQNNQPKGVKRNLRIMIEVSHVNPTA
QMTGSEWKIRIEGRLMGNESEQDQLLTGKPEDDARLCKRFLSFFDRVRVEFPQEEYPHVD
WSKAKSDAGANFDCIEIVRAFPKDYKRKQQSIPIKLIFSVENNPKKYRLSPQLTKILGME
EETRLRIIGALWQYIKSNRLQDSDNRELVNCNAELLEIFGDDKVEFHNAIFKLKDHLFEV
QPIELNFEIKTTRGTPQVVYHFYDMSVFEYHTESQKEQIEFLINCNYDFFNSNQNPSADQ
TSGSSTSKLALNGNLLKKRELKQNIKISNSIEKLKKAYRHMDFFNKMSGDVKTQLSNVII
EQNKWLKVIQEEQTPFYDYAGEQDHAVFYQQNQNWIMSEVESYIEQQQIHLEKQKKALAD
QQSKNDSSHASRADQQDNQNEQSERKSANGAAGSNMGLGAAIKPFSSANIGGSGTSRSGA
YSLR