Identifiers and Description

Gene Model Identifier

Contig19570.0.g37

Standard Name

SMARCC2b

Aliases

Contig19570_0_g37

Description

SWIRM domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005848404.0018838296491823e-56SWIRM domain containing protei
n
SGDYFR037C2.0003218023735366e-33RSC8 SGDID:S000001933, Chr VI
from 229186-227513, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19570.0.g37(coding)
ATGAGTTCAAAAAATAGGAGACCTCAATCATAGAAAAAGAAGAGTAGCTCCAATTTGGGT
AAATCAAATGACCCTTCTTACTTACTCTTATTAAGCTTTAACAAAGATACTAAACTTTAT
TCGCTTGATTTCGCAGAAATGATTAAGCCATAGGAGTAGATTAAACCTGAGGTTGTTAGC
AAGCAAGTCATTCAAATCTCAAACTCAAAGAATCGCAGTAGCAGTGGAGGAAATCACGTT
AATAAAGATGAGCAAGTTTTGGTTGAACCTCAAGCTCAAAGCATTTCCATCAGATTATCA
AACTAAGGAGGTCTAGGAGGTGCAGCGATTCATTCATTAAATGATCACCATGATGTCAAA
CTTGGAGTTATCAATACTTCAATTGACACATCTCTCTAGAGAATGGACGCTGCAAGCGTC
ATCTAGAATCCCTCATTAATCAATAATGATCCTTATAACTTGGCTAAGTTACAAATTACC
AACAAAGTTGTTGTCCCTTCTGCCTCAGCTGACTGGTTTAACCTCGATGATATCCATCAA
CTTGAGAAAGATTCACTGCCAGAGTTCTTTAATGGAAAATATCCATCAAAGACTCCACAG
ATCTACAAAGAGTATAGAAATTTCATGGTTCAGTTATACCGCCAAAACCCTATAGCATAT
TTAACTGCTACAACTTGCAGAAGACACCTTGCTGGTGACGTTTGTTCAATAATGAGAGTT
CATAGCTTTTTAGAGCTCTGGGGACTCATTAACTTCAATGTAGATCCTTACGCAAAACCT
CATAAAATCTCAGTTATCAAAGAAGCATCATACAACAAAGTATTGGTTAATGCTGCAAAC
AAGCATATGCTAGCTAAAAATGAGGAAGAATACTTGAACAACTTATTTGATGTTTAGCCA
CCCATGATAGACTAAACTGTCCAAGCCTAGATAGATTCTTTGAGTTTAAGAAAAATCAAC
ATTCTTACTTCAAAAGATAGACCTTTCTGTGCTTTTTGTGAAACTATTTGTGGATTTTCT
TGGTATGTAAAGAACAATAAAACTGATCATAAGTATTCCAATTAAGTGCAAGTAGAAGAT
TAAAAAGTCGAGGGTTAAGAAGCTCAACCAACATCTGAATCTTATTCTTTATGTCAACCA
TGCTACAAGAAAAATCATTTTCCAACAAATCTTACTGAATAAGATTTCAAGCCACAGTCT
CTTTCTTCCATATAATGGGAAAGAATTCAGAATGATATTAATCCAGAGATTGAGCAAGTA
GCTTCTGCAAAGCAGTCATCTTTATCTCATGAGAATTAGCAGAAGTTAGTAGGTTTAGTA
ATGAAATATGGTGATGATTGGAAGAAGATTGGAGAAGAGATAGGATTAAAGAATAAGCGT
GAGGTAATTTTGGAATTTTTGAGAGCCCCTATTTAAGACTTCAAAGTCGATGAGAATCAA
TATCTTTATCATTATGCTCATGTAAAATCTACCTCTTCAGCCAATTTCAAAGACTTGAAA
GAAATTGAGCCATACAACTAAGTTGACTAGCTATTCTTGTAATGCGAATTACTCTAACAA
TTTGCCAGAGCAGAAGAAACTGTTCTTTCCAAAAGAAAAAGTGAGATGACTCCTGAACAA
AAGGAAGCTAGAGACTAGAAAAGAAGACTTGTGAAAGAAAAAAGAAAGCTTGCCTAAAAG
ATTATGGTTCAGAAATTGATGCTTATGGAAGAAGAACTACAAGAAATGAAAACTGTGGAT
AACACTATCTGCAAAATTAAGCATGAGTACAAGAATTTGAAAAGCCAGATGTTTGCTGAG
AGGTTTTCTCTTACAATCCAAAACAAAAGAATAGCATAGTGA


>Contig19570.0.g37(protein)
MSSKNRRPQSQKKKSSSNLGKSNDPSYLLLLSFNKDTKLYSLDFAEMIKPQEQIKPEVVS
KQVIQISNSKNRSSSGGNHVNKDEQVLVEPQAQSISIRLSNQGGLGGAAIHSLNDHHDVK
LGVINTSIDTSLQRMDAASVIQNPSLINNDPYNLAKLQITNKVVVPSASADWFNLDDIHQ
LEKDSLPEFFNGKYPSKTPQIYKEYRNFMVQLYRQNPIAYLTATTCRRHLAGDVCSIMRV
HSFLELWGLINFNVDPYAKPHKISVIKEASYNKVLVNAANKHMLAKNEEEYLNNLFDVQP
PMIDQTVQAQIDSLSLRKINILTSKDRPFCAFCETICGFSWYVKNNKTDHKYSNQVQVED
QKVEGQEAQPTSESYSLCQPCYKKNHFPTNLTEQDFKPQSLSSIQWERIQNDINPEIEQV
ASAKQSSLSHENQQKLVGLVMKYGDDWKKIGEEIGLKNKREVILEFLRAPIQDFKVDENQ
YLYHYAHVKSTSSANFKDLKEIEPYNQVDQLFLQCELLQQFARAEETVLSKRKSEMTPEQ
KEARDQKRRLVKEKRKLAQKIMVQKLMLMEEELQEMKTVDNTICKIKHEYKNLKSQMFAE
RFSLTIQNKRIAQ