Identifiers and Description

Gene Model Identifier

Contig17870.0.g72

Standard Name

SMARCC2a

Aliases

Contig17870_0_g72

Description

SWIRM domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005848401.99927841627239e-68SWIRM domain containing protei
n
SGDYFR037C1.9998323414791308e-36RSC8 SGDID:S000001933, Chr VI
from 229186-227513, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17870.0.g72(coding)
ATGAAAAAAGGCTAATCATCTAGTTAAGATAACAAATTCTTAATTACTTTGAAGAGAGAC
CCTGCTTCTCTGCTTTACACTTTAGATTCAATTTCTCAACCAAGAGTGTTTGCTAAACCT
GGGTAATTGAACTCACACTAGAAAAACAAAAATTTGAAGAGAACTCATTAACAGATGAAC
AGTGCTGGAAATGGAGCTGATTTTATAAAAAAAGGAGGTAATCAACCACAGAGTTTGGAA
ATTGTTGGTCCAAATAGACCAAAGCGTTAAGCTGCCTAGAAAGATCCAGGAACTTATGCA
AAAGATAGTGTGCCAGATTTTGAATCGGAAAGACGTGGTAGCGGGGACGAGTCTTAACTT
ATAGATGGCAAGGAAGATCTAGATGAAGATGGTCTCGAAAACGATATGGATGAGAGTCAA
ACTAAGATTGATGAAAATGAGATGGAGTACTCAAAGTCATCTTTCATTATACCAAGCTGT
AGTGGATGGTTCAACCTTGACAAGATTCATGAAATTGAAATGCAAAGTTTGCCTGAGTTT
TTCTGCGGAAAGTTTCCTCACAAGAACCCTGTAACATATATGGACTACAGAAATTTTATC
ATTAAGCTATACAGAGAAGCTCCTAACTCTTATTTATCAGCAACTGTATGCCGCAAAAAC
TTGCCAAGTGATGTGTGTAGTATAATCAGATTGCATGCATTCCTTGAACACTGGGGACTT
ATTAACTTTAATGTTGATCCCTAACTAAGACCAATAAAGATTCAACTTGCTGGAAGTGGA
AGTTTGAATGCTAATTTGATTGATGTAGCTGCTAAAGGTTACTTGAAGCTCAATGAGGCA
GAGTAAATTTCTTCATTCTTTCAAAAAGATGATTCTTAAGTTGAAACCAACGCTTCACAG
AATGTCTATTTGATTGCAGCTAAAAAGATCAATTTGATATCAACTCACAAAAGACCAACT
TGCAATTTCTGTGGAAATCTTTGTGGTCCTTATTGGTACAAGAAAAAGCCAAGCATCAAT
ACTAGCAATTTCAGAGAAGAAAATGCTTTGAAAGCTCTAGGTGAATACGACTCTCTTCAT
CACACTTTGAAAAGTTTAACATCCACTTATATGCTCTGCAAAGAGTGCTTCCTTGCTGGT
AATATCCCTAGAATCCTTACAACTTAAGACTTTGAAAAGTTCAGCTTGGAGACCATTTTG
AGAAATCCAGATTTTCAAATGAAAGTAAACATGCTTCACGAAGATGAGGGCTTAACTCAA
AATGACATGTATCAATAGGAATGGTCAGCTTAAGACAGGGAATAGCTTGTTGAAGGTGTT
TCTTAGTATGACAGTAACTGGGAAACAATTTCTGAGAAAGTATTTCAAGGAAGATATTCC
TCAATTGAATGTGCCTATCAGTTTATAGGTTTACCAATTAGTGAATCTCTCTTGTTGAAA
TTCTAAAATGCATCTTTATAGCAATAAGAGGAGTTTGTCAATAATTATGTCCCCACTGTC
TTCTAAGACTTCTCAAATCCTTTATTGTCATAATTAGCGATTTTAGCCAAGAGTCTTGAA
TATTAGGACTAAGCACCAACTGAAGCTGATAACTAAAAATCCATATAAGAACTTTTCAAA
AAGTAAGTTGAGCAACAATAATAGATATAATAACATGAAAATGAACAGTAGGAGAGAAGA
ACAACTAGAAAGTAACAAGCCTAGAAGAAAAAAGAGCTGGACCAAGTTTAAGAGACTCAA
TTAAAGCAAGTTCATGAAGATATTGGAGACTTCTACTTGATACCCTAGGTCAAAGCTCAA
GCTTGCATGACCAGAGAAATGCTTGAAACCATTTCTGAGAGAGCGAGCCAAAAATCTCGA
AGACTTGCAAAGCAGCAAAGAAAGGAGATTAAGAAATACCTTAATCTCGCTATTTATCAT
CAGCAGAAGAAGCTTCAAGAGAAAGCTAAATTCATGAGAGACTTTTGGAAGATATTTGAT
GTGGAATCGAATGACCTGCACTTTATGAAGGAAGAGGCTTTGGCTGAGAGAGTTGCACTG
TCTGTAATCAAAAGCGGAGAAATCAAAGGTACACAGACTGAGAAAATATTGGCTACTAAT
GAGTTTGCTTCAACTAATTCTTTATTGAGACAAATTATTTGA


>Contig17870.0.g72(protein)
MKKGQSSSQDNKFLITLKRDPASLLYTLDSISQPRVFAKPGQLNSHQKNKNLKRTHQQMN
SAGNGADFIKKGGNQPQSLEIVGPNRPKRQAAQKDPGTYAKDSVPDFESERRGSGDESQL
IDGKEDLDEDGLENDMDESQTKIDENEMEYSKSSFIIPSCSGWFNLDKIHEIEMQSLPEF
FCGKFPHKNPVTYMDYRNFIIKLYREAPNSYLSATVCRKNLPSDVCSIIRLHAFLEHWGL
INFNVDPQLRPIKIQLAGSGSLNANLIDVAAKGYLKLNEAEQISSFFQKDDSQVETNASQ
NVYLIAAKKINLISTHKRPTCNFCGNLCGPYWYKKKPSINTSNFREENALKALGEYDSLH
HTLKSLTSTYMLCKECFLAGNIPRILTTQDFEKFSLETILRNPDFQMKVNMLHEDEGLTQ
NDMYQQEWSAQDREQLVEGVSQYDSNWETISEKVFQGRYSSIECAYQFIGLPISESLLLK
FQNASLQQQEEFVNNYVPTVFQDFSNPLLSQLAILAKSLEYQDQAPTEADNQKSIQELFK
KQVEQQQQIQQHENEQQERRTTRKQQAQKKKELDQVQETQLKQVHEDIGDFYLIPQVKAQ
ACMTREMLETISERASQKSRRLAKQQRKEIKKYLNLAIYHQQKKLQEKAKFMRDFWKIFD
VESNDLHFMKEEALAERVALSVIKSGEIKGTQTEKILATNEFASTNSLLRQII