Identifiers and Description

Gene Model Identifier

Contig1260.1.g26

Standard Name

SMARCB1

Aliases

Contig1260_1_g26

Description

SNF5 / SMARCB1 / INI1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003041504.999723464643358e-28conserved hypothetical protein
SGDYLR321C0.00000000030007160092483236SFH1 SGDID:S000004313, Chr XII
from 777864-776584, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1260.1.g26(coding)
ATGATGAGTTAATACGATTTAGACAGAGATAAAGAAATCAAGCTGAGACTGCAAGAGATT
ATGACAAAATACAATATTAAGCAAGTCGAGGTGGCAAGAGAGACAGGAATACATCATTCA
TCTCTCTCATTGTGGCTGTAAGGCAAGATTAAGGGACATATGGTTAAAATTTCAGAAACA
ATTGAGAACTATCTTGAAAACTTCATGTCTAATAAGCCTCGTATGAACACTATGCATATT
TCGAAGCTTAACCTTTTAAAATCTCCAAACAACAGACTTGATGAGGATCTAGATTAGAAT
AATGGATTCGGTACTTTAATCCCAATCAAATTAGACTTGGAAATTGAATAAAAGAGGCTA
AAGGAGAATTTTTTGTGGGATAAAAATGAGCCATATTTGACACTAGAAAATTTCGCAAAG
ATATTGGTAGAAGAACACAATTTACCTGCTACTTATGAAAGTGAAATTATCAATGCAATG
AAGAAATAAATCAATTCTTTCAGACCATACAAACCTGTTGAAGGGGAATTAGTAAGAGTC
ATAAAGTTGAATGTGAGAATTGGAAATATTATTTTGAGGGATTAATTTGAATGGGACATT
AATAATCCAAGAAACTCGCCAGAGGTAAATATTCAATTCAATTTAAGACTTTCTAATAGG
ATTTTGCTGAGAGTTTGTGCACTGATCTCGGCTTAGGAAGTGAGTTTATGCTTCCAGTAG
CTCATTAAATCAGAGAATAAATCCTTGAATATCAAAGGACTGCTCATTAAGATAAAAGAA
TGCAAGTGTATTACAGTAAAAGTAATGACTATCAATATGGAAATTAACGAGGCTACACAG
TTTAAGATTCACTAAGACTGGGTGCAGGCCCACAAGATTTAGGTGATGGCATAAAAACTA
TGA


>Contig1260.1.g26(protein)
MMSQYDLDRDKEIKLRLQEIMTKYNIKQVEVARETGIHHSSLSLWLQGKIKGHMVKISET
IENYLENFMSNKPRMNTMHISKLNLLKSPNNRLDEDLDQNNGFGTLIPIKLDLEIEQKRL
KENFLWDKNEPYLTLENFAKILVEEHNLPATYESEIINAMKKQINSFRPYKPVEGELVRV
IKLNVRIGNIILRDQFEWDINNPRNSPEVNIQFNLRLSNRILLRVCALISAQEVSLCFQQ
LIKSENKSLNIKGLLIKIKECKCITVKVMTINMEINEATQFKIHQDWVQAHKIQVMAQKL