Identifiers and Description

Gene Model Identifier

Contig5149.0.0.g110

Standard Name

SMARCA2b

Aliases

Contig5149_0_0_g110

Description

SNF2 family N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • eukaryotic translation initiation factor 2 complex (IEA) | GO:0005850

Molecular Function

Domains

  • ( pfam00176 ) SNF2 family N-terminal domain
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam07529 ) HSA
  • ( pfam07541 ) Eukaryotic translation initiation factor 2 alpha subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012456409.997093137033517e-262HSA family protein
SGDYOR290C9.995404496431436e-166SNF2 SGDID:S000005816, Chr XV
from 860258-855147, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5149.0.0.g110(coding)
ATGCAAGCTACCTTCGAAGTTGTCAAAAAGCTAGAAAATGAATAGAAAGCACTGTAAGAT
CAACAGAATGGCCAAGTATAGTTCGGGAACTAAATAAACTAGTACAAAGATTTTGTTCTG
GCAAACTTTGGAAATCAAAACTAAAACAAGCATAACGCTATGAGACCTGGTTCCACTGCT
GATTAAATAACTCACAGAAGAATGATGGTTCATTAATAAACCTAAGAGCTTTATAGAGAA
AGATTCGAAGATGATATGCAAGTCAACTACAAAGACTTGTGGGACTATATTAATAAGAAA
CTAAAGAATGAGGGTGAAAATACCTTCAAAATTGCTTCAGGAGATCCTTCTTCAGAGTAC
TTACAACAGTTTCTTTCACATTTAAACGAGAGTGATGAGATAAATCAGTTGGCTGAAGAG
CTTCAAAAGGTTATCTCAGAGAAAGATACACCAGCTGACATGAAGAAAAAAGCTGAAATG
CAATTGAAATTGCTTAAGCTTAAGCCTCTTTAGAATTAGGTGAGAGATGAGATACTTCAA
AGATACAATCACAATAAAATTGCCATTTAAAATTACAGATAGTAAACTTAAGGCGATCAT
TTATACGAGAGACAACTAGTTGATAGAGAATTTTATAAGAGAGCAAAAGTCTATCAAAAT
AGCAAAAAAGAGGCAAGAACTCTTGATAGATTTGAGTAGTAGATGAGATCTGGCCAAGAG
TTAAGAAAGAAAACAAGGCACAAGGAGCTCTTAAATGAGATTCTATTTCATGCCAACAAG
TTTATGGAGTTTCACAAGAAACGTCAAAACTTCATCAGAAAGAAGGGACTTATAATTAAG
ACTAGTCTAGACTCTAAAGAGAAGAAAGAACAAATGGCAAGAGACAAGGAAGAGCGTGAT
AGAATTAAGATGCTCAGAGAAAATAACATAGAAGGCTATATCACTATGATCAACACTCAG
AAGAATTCTAGACTACTACAAATTCTTGAACAGACTCACAAGTATCTCGAGCAGCTAGGA
GCCAAAGTTAGCGTTTAAAAACTTGAAAGTGAAAAGAGTAAAAAGAAAAAGGTTGTTGAT
AAAGAAAAAGAAGGCAACATCGATGCTGACGAAGAATTAAAAGAGGATGAAGTTTTGTAT
GATGAATATGGTAATCTTATAAATGCGGATGGTGAAGAGGAGCTTCCAGACAACGAGAAA
ATTAAAAGTAATTTAAAAAACAGCTCTAAAATCTATTACAATATCACTCATACAATTTAA
GAGGAGATCAAAGAACAACCAAAGATGATTAAGGGTGGTTAGCTAAAATCATATCAGTTA
ATTGGTTTGAATTGGATGGTAAGTTTGTACAACAATAACTTAAACGGTATTCTGGCTGAT
GAAATGGGTCTTGGTAAAACAATTTAAACCATCTCACTTTTCAGTTACTTGATTGAAGTT
AAAGGTAATGAGGGACCATTCTTAGTAGTTGTACCCTTGACCACAATTTCTAATTGGATA
ATGGAATTTGAGAAGTGGGCTCCAGATATCAGAAAGATTGTGTATAAGGGAAAAAAGCAT
GAAAGACCTTTGCTTGCACAACACTTAAAGAATGATAAGTTCCATGTAGTGCTGACTACA
TATGAGTATGTATTAAATGATAAAGCTACCCTCTGTAAAGTTCCATGGCAATACATTATT
GTTGATGAGGGTCACAGAATGAAGAATTAAAAATCTAAATTCGCTTTAACCCTAGGATAA
CAATATCAGTCCGCACATAGAATACTTTTGACTGGTACTCCTCTTTATTATAACTTGAGT
GAGCTTTGGGCTCTTTTGAATTTCCTTCTCCCCAAGATTTTCTCATCTTGTGATGAATTT
TAGAAGTGGTTTGATAAACCTCTTAGCAAGATTCATCCTCTCACAAATTCAAAAGTAAAT
CCTACTGAAAAACAAGCGTTCGAACTTTCAGAAGAAGAGCAACTGCTTATCATCAATAGA
CTGCATTAAGTTTTAAGACCTTTCTTATTGAGAAGAGTAAAAGCTGAAGTTGAAAAAGAA
TTGCCAAACAAAATCGAAATGGTCATTAAAGTAGACTTGTCAGCTTGGTAAAGAATTGTC
TATGATGGAATAACAGATAATGGTAAATTAGCAAGGGATCCATCTACTGGCAAACTTGGA
AATCTTGCCCTTAGAAACACTGTCATGCAGCTTAGAAAAATTTGCAATCATCCCTATCTA
TTTTTAGACTACTTTGAACCAGAAGATTTGAGGGAAAATATTTACAGAAGTAGTGGTAAA
TTCGAACTGATGGACAGAATTTTACCAAAGCTCATTGCAACTGGCCACAAAATATTGATC
TTCTCTTAATTTACTCAACTTATGGATATAATGCAAATCTTCTTTGATTTCAAAGGCATA
AAGCATTTAAGACTGGATGGTGGCACAAAGCATGAAGACAGAGCAAAGAACTTAGAAATT
TTTAGTTCTGCTCAATCAGATTTCTAAGTATTCTTGCTCTCTACTAGAGCTGGTGGTCAT
GGTTTAAATCTGCAAGTTGCTGATACTGTAATAATCCTCGATTAAGATTGGAATCCATAA
ATGGATATGCATGAAAATTGGCGTTGGTTTAATTTAGAGAGAATTAACTATTTGGTCTAA
TCTTGTTCAATCTTTTCAATTTACGTTGGCATGATCAAAGATTTCTTCCAATTCCTAATG
GAATGTCTTTTTATATCCCAAAATCTAGAGCTACATTTGCTTTTTACCAGATATACGGGT
TTGGAATTTTTACACTTTTGA


>Contig5149.0.0.g110(protein)
MQATFEVVKKLENEQKALQDQQNGQVQFGNQINQYKDFVLANFGNQNQNKHNAMRPGSTA
DQITHRRMMVHQQTQELYRERFEDDMQVNYKDLWDYINKKLKNEGENTFKIASGDPSSEY
LQQFLSHLNESDEINQLAEELQKVISEKDTPADMKKKAEMQLKLLKLKPLQNQVRDEILQ
RYNHNKIAIQNYRQQTQGDHLYERQLVDREFYKRAKVYQNSKKEARTLDRFEQQMRSGQE
LRKKTRHKELLNEILFHANKFMEFHKKRQNFIRKKGLIIKTSLDSKEKKEQMARDKEERD
RIKMLRENNIEGYITMINTQKNSRLLQILEQTHKYLEQLGAKVSVQKLESEKSKKKKVVD
KEKEGNIDADEELKEDEVLYDEYGNLINADGEEELPDNEKIKSNLKNSSKIYYNITHTIQ
EEIKEQPKMIKGGQLKSYQLIGLNWMVSLYNNNLNGILADEMGLGKTIQTISLFSYLIEV
KGNEGPFLVVVPLTTISNWIMEFEKWAPDIRKIVYKGKKHERPLLAQHLKNDKFHVVLTT
YEYVLNDKATLCKVPWQYIIVDEGHRMKNQKSKFALTLGQQYQSAHRILLTGTPLYYNLS
ELWALLNFLLPKIFSSCDEFQKWFDKPLSKIHPLTNSKVNPTEKQAFELSEEEQLLIINR
LHQVLRPFLLRRVKAEVEKELPNKIEMVIKVDLSAWQRIVYDGITDNGKLARDPSTGKLG
NLALRNTVMQLRKICNHPYLFLDYFEPEDLRENIYRSSGKFELMDRILPKLIATGHKILI
FSQFTQLMDIMQIFFDFKGIKHLRLDGGTKHEDRAKNLEIFSSAQSDFQVFLLSTRAGGH
GLNLQVADTVIILDQDWNPQMDMHENWRWFNLERINYLVQSCSIFSIYVGMIKDFFQFLM
ECLFISQNLELHLLFTRYTGLEFLHF