Identifiers and Description

Gene Model Identifier

Contig934.1.g131

Standard Name

SMARCA2a

Aliases

Contig934_1_g131

Description

SNF2 family N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012456409.997093137033517e-262HSA family protein
SGDYOR290C9.997093137033517e-262SNF2 SGDID:S000005816, Chr XV
from 860258-855147, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig934.1.g131(coding)
ATGCAAGCTACCTTCGAAGTTGTCAAAAAGCTAGAAAATGAATAGAAAGCACTGTAAGAT
CAACAGAATGGCCAAGTATAGTTCGGGAACTAAATAAACTAGTACAAAGATTTTGTTCTG
GCAAACTTTGGAAATCAAAACTAAAACAAGCATAACGCTATGAGACCTGGTTCCACTGCT
GATTAAATAACTCACAGAAGAATGATGGTTCATTAATAAACCTAAGAGCTTTATAGAGAA
AGATTCGAAGATGATATGCAAGTCAACTACAAAGACTTGTGGGACTATATTAATAAGAAA
CTAAAGAATGAGGGTGAAAATACCTTCAAAATTGCTTCAGGAGATCCTTCTTCAGAGTAC
TTACAACAGTTTCTTTCACATTTAAACGAGAGTGATGAGATAAATCAGTTGGCTGAAGAG
CTTCAAAAGGTTATCTCAGAGAAAGATACACCAGCTGACATGAAGAAAAAAGCTGAAATG
CAATTGAAATTGCTTAAGCTTAAGCCTCTTTAGAATTAGGTGAGAGATGAGATACTTCAA
AGATACAATCACAATAAAATTGCCATTTAAAATTACAGATAGTAAACTTAAGGCGATCAT
TTATACGAGAGACAACTAGTTGATAGAGAATTTTATAAGAGAGCAAAAGTCTATCAAAAT
AGCAAAAAAGAGGCAAGAACTCTTGATAGATTTGAGTAGTAGATGAGATCTGGCCAAGAG
TTAAGAAAGAAAACAAGGCACAAGGAGCTCTTAAATGAGATTCTATTTCATGCCAACAAG
TTTATGGAGTTTCACAAGAAACGTCAAAACTTCATCAGAAAGAAGGGACTTATAATTAAG
ACTAGTCTAGACTCTAAAGAGAAGAAAGAACAAATGGCAAGAGACAAGGAAGAGCGTGAT
AGAATTAAGATGCTCAGAGAAAATAACATAGAAGGCTATATCACTATGATCAACACTCAG
AAGAATTCTAGACTACTACAAATTCTTGAACAGACTCACAAGTATCTCGAGCAGCTAGGA
GCCAAAGTTAGCGTTTAAAAACTTGAAAGTGAAAAGAGTAAAAAGAAAAAGGTTGTTGAT
AAAGAAAAAGAAGGCAACATCGATGCTGACGAAGAATTAAAAGAGGATGAAGTTTTGTAT
GATGAATATGGTAATCTTATAAATGCGGATGGTGAAGAGGAGCTTCCAGACAACGAGAAA
ATTAAAAGTAATTTAAAAAACAGCTCTAAAATCTATTACAATATCACTCATACAATTTAA
GAGGAGATCAAAGAACAACCAAAGATGATTAAGGGTGGTTAGCTAAAATCATATCAGTTA
ATTGGTTTGAATTGGATGGTAAGTTTGTACAACAATAACTTAAACGGTATTCTGGCTGAT
GAAATGGGTCTTGGTAAAACAATTTAAACCATCTCACTTTTCAGTTACTTGATTGAAGTT
AAAGGTAATGAGGGACCATTCTTAGTAGTTGTACCCTTGACCACAATTTCTAATTGGATA
ATGGAATTTGAGAAGTGGGCTCCAGATATCAGAAAGATTGTGTATAAGGGAAAAAAGCAT
GAAAGACCTTTGCTTGCACAACACTTAAAGAATGATAAGTTCCATGTAGTGCTGACTACA
TATGAGTATGTATTAAATGATAAAGCTACCCTCTGTAAAGTTCCATGGCAATACATTATT
GTTGATGAGGGTCACAGAATGAAGAATTAAAAATCTAAATTCGCTTTAACCCTAGGATAA
CAATATCAGTCCGCACATAGAATACTTTTGACTGGTACTCCTCTTCAAAATAACTTGAGT
GAGCTTTGGGCTCTTCTAAATTTCCTTCTCCCCAAGATTTTCTCATCTTGTGATGAATTT
TAGAAGTGGTTTGATAAACCTCTTAGCAAGATTCATCCTCTCACAAATTCAAAAGTAAAT
CCTACTGAAAAACAAGCGTTTGAACTTTCAGAAGAAGAGCAACTGCTTATCATCAATAGA
CTGCATTAAGTTTTAAGACCTTTCTTATTGAGAAGAGTAAAAGCTGAAGTCGAAAAAGAA
TTGCCAAACAAAATCGAAATGGTCATTAAAGTAGACTTGTCAGCTTGGTAAAGAATTGTA
TATGATGGAATAACAGATAATGGTAAATTAGCAAGGGATCCATCTACTGGCAAACTTGGA
AATCTTGCCCTTAGAAACACTGTCATGTAGCTTAGAAAAATTTGCAATCATCCCTATCTA
TTTTTGGATTATTTTGAACCAGAAGACTTAAGGGAAAATATTTACAGAAGTAGTGGTAAA
TTCGAACTGATGGACAGAATTTTACCAAAGCTCATCGCAACTGGCCATAAAATATTGATC
TTCTCTTAATTTACTCAACTTATGGATATAATGCAAATCTTCTTTGATTTCAAAGGTATA
AAGCATTTAAGACTGGATGGTGGCACAAAGCATGAAGACAGAGCAAAGAACTTAGAAATT
TTTAGTTCTGCTCAATCAGATTTCTAAGTATTCTTGCTCTCTACTAGAGCTGGTGGTCAT
GGTTTAAATCTGCAAGTCGCTGATACTGTAATTATCTTCGATTCTGATTGGAATCCATAA
ATGGACGAACAAGCTAAGGACAGAGCTCATAGAATCGGTTAGAAGCGTGAGGTCAGAGTG
TACAGGTTGATAACTACTACCAAAATTGAAGAGGGTATTTTAAGCAAGGCCACTTAAAAG
AAAGATCTTGATGCCAAGATCATTCAAGCTGGTATGTTCAATGATAAAGCAAGCGATGTA
GATAGGCAAAAGAAACTTGAGGATTTAATCAGAAAAGACTACGAGGACGACGGAGAAGGC
GAAAACGAAACTGAAATTCCTAATGATGATTAAATTAATGACATAATCTCAAGAGACGTA
GAGGAGTATGAAATATTCACCAGGATGGATTAAGAAAGATACATTGAAGAAAAGAAAGAA
GAGAGAATGGAAGAAATCAGGAGAAGATATGAGAGGGAAGGAAGACAAACAAACCTTTCT
AATATGAACTACAGACTATTGCAAGATTGGGAGGTACCTGAGTGGATCAAAATTAAGCCT
GACGACCCTAATAAGCTTACCGAGGAATTTGGAATGGGAAAGAGACAGAGAAAGCAAATT
AACTATAACGATGAGATGAGTGAGGGCTAATGGCTAAAGATGATCGAATCGGGAGCTGAT
GCTAATGATGAGAAGTTGAAAAAGAGAAGACATGATCCATCCAACAGACCAACTGGAGCT
TATGATACTTCTAACTTGAATTCAAGAAATAATGGTGGAGCTGATAATGGCATTGTGGGT
AGCAGCGCATAAAAAAGAAGAAGAATGAATGAAACTTCAGTTAGTATTTTAAGCGATGAA
GAGGATGAAGATGAACAATTTGAAGTTTCAAATTCTAAAACCAGAAAAGAAGACGTTAAG
AATGTGAAAGTTGCAAGACCCTAGAACAATGAGGAGAGCAAGAGTAGTTCAAGATCAGGG
AACAGAAAAAGACAGTCAAATAGCAAACTGGAAACTAACTTTGATCATATGCCAAATGTC
ATCGGCAACGAGGATGATGAGGACTTGGTTATGAGTGAGCAAGAAGAAGGTCAAATTGTA
GACTCACCAGTTAATCACAACAATGGCAATGTAGGATCTGGAATGTAAAATGATAAAAGT
GGAGCAACTGGAAATGGTAGACAGAGAAGAAGTGCAGCTCCTACAAACCTTAGAGAAAAA
TGA


>Contig934.1.g131(protein)
MQATFEVVKKLENEQKALQDQQNGQVQFGNQINQYKDFVLANFGNQNQNKHNAMRPGSTA
DQITHRRMMVHQQTQELYRERFEDDMQVNYKDLWDYINKKLKNEGENTFKIASGDPSSEY
LQQFLSHLNESDEINQLAEELQKVISEKDTPADMKKKAEMQLKLLKLKPLQNQVRDEILQ
RYNHNKIAIQNYRQQTQGDHLYERQLVDREFYKRAKVYQNSKKEARTLDRFEQQMRSGQE
LRKKTRHKELLNEILFHANKFMEFHKKRQNFIRKKGLIIKTSLDSKEKKEQMARDKEERD
RIKMLRENNIEGYITMINTQKNSRLLQILEQTHKYLEQLGAKVSVQKLESEKSKKKKVVD
KEKEGNIDADEELKEDEVLYDEYGNLINADGEEELPDNEKIKSNLKNSSKIYYNITHTIQ
EEIKEQPKMIKGGQLKSYQLIGLNWMVSLYNNNLNGILADEMGLGKTIQTISLFSYLIEV
KGNEGPFLVVVPLTTISNWIMEFEKWAPDIRKIVYKGKKHERPLLAQHLKNDKFHVVLTT
YEYVLNDKATLCKVPWQYIIVDEGHRMKNQKSKFALTLGQQYQSAHRILLTGTPLQNNLS
ELWALLNFLLPKIFSSCDEFQKWFDKPLSKIHPLTNSKVNPTEKQAFELSEEEQLLIINR
LHQVLRPFLLRRVKAEVEKELPNKIEMVIKVDLSAWQRIVYDGITDNGKLARDPSTGKLG
NLALRNTVMQLRKICNHPYLFLDYFEPEDLRENIYRSSGKFELMDRILPKLIATGHKILI
FSQFTQLMDIMQIFFDFKGIKHLRLDGGTKHEDRAKNLEIFSSAQSDFQVFLLSTRAGGH
GLNLQVADTVIIFDSDWNPQMDEQAKDRAHRIGQKREVRVYRLITTTKIEEGILSKATQK
KDLDAKIIQAGMFNDKASDVDRQKKLEDLIRKDYEDDGEGENETEIPNDDQINDIISRDV
EEYEIFTRMDQERYIEEKKEERMEEIRRRYEREGRQTNLSNMNYRLLQDWEVPEWIKIKP
DDPNKLTEEFGMGKRQRKQINYNDEMSEGQWLKMIESGADANDEKLKKRRHDPSNRPTGA
YDTSNLNSRNNGGADNGIVGSSAQKRRRMNETSVSILSDEEDEDEQFEVSNSKTRKEDVK
NVKVARPQNNEESKSSSRSGNRKRQSNSKLETNFDHMPNVIGNEDDEDLVMSEQEEGQIV
DSPVNHNNGNVGSGMQNDKSGATGNGRQRRSAAPTNLREK