Identifiers and Description

Gene Model Identifier

Contig12570.0.g36

Standard Name

SMARCA1c

Aliases

Contig12570_0_g36

Description

SNF2 family N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00176 ) SNF2 family N-terminal domain
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam00249 ) Myb-like DNA-binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001376109.997093137033517e-262SNF2 family N-terminal domain
containing protein
SGDYOR304W6.000153576809675e-162ISW2 SGDID:S000005831, Chr XV
from 884514-887876, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12570.0.g36(coding)
ATGATGCAGTAAAAGAGTGAATCCCAAAATAGATTAGATGAGTTATTGAAGAAAGCTGAG
TAGTATACAAGACTCATCTTTTTAAAGCAAGCTAAAAAGCCAGCAAAAAATCAAGCTAAT
AAAAAGGATGAAGGTAAATCTTCAAAGAGAAAGCATGATCACAGAAAAAGCTAGGACATT
GATGACATGCAAAACGAAGAGAGTTAAGGAGGAGAGAGTATTAGATTCACAGATTAGCCT
AGCATGTTGAAGGGTGGAAAACTCATGCCTCATCAAATTGACTCTTTAAACTGGATGATA
ACTCTATATGACTTAGGACTCAATGGAATTCTTGCTGATGATATGGGTTTGGGTAAAACC
ATCCAAGCAATCTCTATGATGGTGTACCTCTATCAGTACAAAAAGGTTTAGGGACCTCAC
TTGATTATTACTCCCAAGTCAACAATCAGTAATTGGATGAAAGAGTTTGAGAAATGGGCT
CCTTTCTTGAAAGTAGTCAACCTCATCCCCACTATGGAACACAGAAAGGAAATCCTGAAA
GAGTAAATGTAACCTGGTACATTCAATGTCTGTGTGACAACCTATGAAGGTGTGAACATT
TGCTCAGGAGCTTTACAAAAGTATGACTGGCACTATTAAGTTTACGATGAAGCTCACAAG
CTCAAAAACATTGATGCCAAAATCAGTCTAACCTCAAGAAAGCTTTCTTGTAGAAATAGG
ATATTAATGACTGGAACTCCACTACAAAATAACTTAAGAGAGTTGTTTGGAATACTCAAC
TACTTAATGCCTGAAATTTTCGGTTCAGAGGATGACTTTAATGACTGGTTTTGTATTGAA
GATCCAAGTGTGGGACAGAAGATGACTATAGATTCCATTTAGAAACTTCACAAGATTTTG
AGGCCATTTTTGTTGAGAAGAGTCAAGAAAGATTTAGAAGTCAAACTTCCAGACAAAATT
GAGATAAATGTGAAAATCAATATGACTAAGATGTAATTGGAGTTATATGAACAACTCTTA
AAGACCACCAGCATTTTCAATAATAAAAATACCACTGTGAAAACCTACTTCAATTTACTC
ATGCAACTAAGAAAAGCATGTAATCATCCATACCTTTTTGATGGGATAGAACCTGAGGGA
GCTGAAGAATACGGTGAACACATTGTTGACAATTGTGGAAAGATGAGATTCTTAGATAAG
CTTCTTAAGAAAATATCCTCACAAAAAGAATAAGTCTTGATTTTTTCATAATTTACCTCA
GTCTTAGATATCATTGAAGACTATTGCTTAATGAGAGGTTTCCAATTCTGCAGACTTGAT
GGTACCACTGATCTAGAAGAAAGAGAAAGAATGATCACTGAATTTACAGCACCTAATTCA
GAGTTATTCATATTCTTGCTTTCAACAAAGGCTGGTGGTCTTGGTCTCAACTTAATGTCA
GCAAATCATGTGGTAATTTATGACTCTGACTGGAATCCTCAAGTTGATCTTCAAGCTATG
GACAGAGCTTATCGTATCGGTTAGAAAAAGGACGTTTTCATCTATCGATTGATCACTAAG
CCTTCAATTGAAGAAAAGATCATTGAGAGATAAGCTATTAAACTCAAGCTGGATTAAGTT
ATCATTCAGCAAGGAAAAACTGCCTCTATCTCAAGTAACTTGAGCAAAGATGAGTATGAA
AAGATTCTTCTCGCTGGTGCTGCTCTGATCCTTTAGCAAAAGTAGTAAGCTTTCCAAGAG
GAAGAAATCGATATAGATAAACTTATAGAAGAGGGAGTTTAAGTCGCTAGACAACTAAAG
GAAAATGCTGAAAAGCAAGCTGATTAGATTTCAAATAGCTTCGATTTCTCATACAACCGA
ACTGACCTTTTGTAATTTCAAGACGTCGATTACAGAGCAGAAAAGGGAAAGTTTTAAGAG
ATTTGGAAATTGGAGCAATAGAAAAAGATATTTGATGCTTAGAAACATTTAACAGATACA
GAAGGGTTATATAACAGGCAAAGGAGATATGCTGCAATGCAAAAATATTAAGACCAACCT
GCTATGTACAATTTGGATAATCAAAAGAAGGGTACGAGAGATCCTGATTATGTGTTGCCT
CCAAAAAAGCAAAAGCTTACTATGCTTGCAGCTGTGTATGACTTCCAGTTCTATTAAGAA
TATGATCTCATTAAGGAATAGATTGCCTACCTCAAAGAAAAAATTAACTAGAGAGAATTG
GTCACTGATGAAGAGCTTAATTCTTTAAAAGAGTTATTGAGTACAGGTTTTCATAATTGG
ACCATAAAAGAGTATTAAAAATTTGTGAAAGCTATCAGAAAGTTTGACATGCTGGATATC
AAGTCCATAGCTGAGTATATTGAAACTAAGACCGAGGAAGAAGTTCAAGAGTATATGAAT
GTTTTTCTTCTCAGATTCAAAGAGCTTAAAGAAAAAGATGTAGTCTTGTCAAAAATCTAC
AACATGAATCTTGAGTAGAAGATTCTTGAGACTATCAGAGACTTTGATATAAACAAAAAC
TATGTGATGCTTTTGCAAGAGAACAACTACTACAACAGAAATTTGTATTTGGCTACAATC
GAGAAAGAGCACAACAAGATGGTCAACCCTGGAAAGAAGGAAAAGCCTCAAGATTTGCAA
TTGAAGATTGATCACTTCTTTCACTCTTAAACTTCTAAGATGGTGTAGGAACAATTGAGA
TATATCGCTTTAGCAGTCAGAGCTGAGGATACACTGAGAGGACATTTGTCTCACCAAAAT
GAGAGAAAGAGAATGAGAGCTATGATTGAGAGATCAAAGCAATTCAGTCAAGGTTACTAG
GAAGGAATTTCTGCAAAAGAAAAAGATTTAGTTAAGAATGATGCTGCAAAAGAAATTAAG
CAAGAATCACACTAAGTCAAGAGAGTTGGACCAATTGATGAGAACCTCAAGTATGGAAGG
AGAAAGAAAACTGCTAATCTATTCAAGAATACTTAGTGA


>Contig12570.0.g36(protein)
MMQQKSESQNRLDELLKKAEQYTRLIFLKQAKKPAKNQANKKDEGKSSKRKHDHRKSQDI
DDMQNEESQGGESIRFTDQPSMLKGGKLMPHQIDSLNWMITLYDLGLNGILADDMGLGKT
IQAISMMVYLYQYKKVQGPHLIITPKSTISNWMKEFEKWAPFLKVVNLIPTMEHRKEILK
EQMQPGTFNVCVTTYEGVNICSGALQKYDWHYQVYDEAHKLKNIDAKISLTSRKLSCRNR
ILMTGTPLQNNLRELFGILNYLMPEIFGSEDDFNDWFCIEDPSVGQKMTIDSIQKLHKIL
RPFLLRRVKKDLEVKLPDKIEINVKINMTKMQLELYEQLLKTTSIFNNKNTTVKTYFNLL
MQLRKACNHPYLFDGIEPEGAEEYGEHIVDNCGKMRFLDKLLKKISSQKEQVLIFSQFTS
VLDIIEDYCLMRGFQFCRLDGTTDLEERERMITEFTAPNSELFIFLLSTKAGGLGLNLMS
ANHVVIYDSDWNPQVDLQAMDRAYRIGQKKDVFIYRLITKPSIEEKIIERQAIKLKLDQV
IIQQGKTASISSNLSKDEYEKILLAGAALILQQKQQAFQEEEIDIDKLIEEGVQVARQLK
ENAEKQADQISNSFDFSYNRTDLLQFQDVDYRAEKGKFQEIWKLEQQKKIFDAQKHLTDT
EGLYNRQRRYAAMQKYQDQPAMYNLDNQKKGTRDPDYVLPPKKQKLTMLAAVYDFQFYQE
YDLIKEQIAYLKEKINQRELVTDEELNSLKELLSTGFHNWTIKEYQKFVKAIRKFDMLDI
KSIAEYIETKTEEEVQEYMNVFLLRFKELKEKDVVLSKIYNMNLEQKILETIRDFDINKN
YVMLLQENNYYNRNLYLATIEKEHNKMVNPGKKEKPQDLQLKIDHFFHSQTSKMVQEQLR
YIALAVRAEDTLRGHLSHQNERKRMRAMIERSKQFSQGYQEGISAKEKDLVKNDAAKEIK
QESHQVKRVGPIDENLKYGRRKKTANLFKNTQ