Identifiers and Description

Gene Model Identifier

Contig11737.0.g12

Standard Name

SMARCA1b

Aliases

Contig11737_0_g12

Description

SNF2 family N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR304W9.997093137033517e-262ISW2 SGDID:S000005831, Chr XV
from 884514-887876, Genom...
T. thermophilaTTHERM_001376101.9991691033935208e-179SNF2 family N-terminal domain
containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11737.0.g12(coding)
ATGCAACCAGAGGAATACGATTCTGAGTATGAAGACTCAGAGAGCAAGAAAGTTGTAAAG
AACCGAGGTGATTAGGATGTTTAATTCAATCATAGTCAAGTTTCAGTTGAAGAGGAGTAG
TAACTTATTTAAAAGAGCAAAACTAAACTTGAAAAGCTTCTCTGTCAACCTGATATCTTT
GATACTTTAAGAAGGATTAACAATGGATAGATAAAATCTTATGACGAGCTAGATTAAAAT
CATGCCTAAAATCAGGCTTTAGCCTAGAACTAATCTAGAAGACGTGGTAACAACGCAAAG
AATGATGACCTAGAAGAGCTAAATTAAACAGAGAATGATAAGCTGTTCGAAATCTAAAAG
ATTGAAAAATAGCCAGATAACCTGATAGGTGGAATTCTCCGTGATTATTAAGTTGAAGGT
TTAAATTGGTTGTATAAGCTTCAGTAAACTAAGCTGAATGGTATTTTAGCTGATGAAATG
GGACTTGGTAAAACAATATAGTCAATTGCTATTATGGCTTTAGTTGAGTCATTCAAAACT
CAAGAGTAGAGAGAAAGTAGAAAAACTCATCATATTGTAATTGTTCCAAAGATTGTTTTG
GGTAAATGGAATAAGGAAATTTAAGAATGGGTACCATCTCTTAGACTTAAACAATTCTAT
GGGTCTAACGAAGAGAGAGAAATTCAAAAGTAAGAAATGAGACAACATCAGTTTGATATC
ATGCTAACTACATTCGAAACTGTGATAAGAGAGAAAGGTGAACTATCTAAGTACCACTTT
GAGTTTTTAATTCTAGATGAAGCTTAGAGAATTAAAAATGATGAGAGTGTTTTGTCTTAA
GTCTTGAGAAAGTTTAAAACTCAGCACAGAATTCTTTTGACTGGTACTCCTCTGCAAAAT
AATCTCAAGGAACTTTGGGCTTTATTAAATTTCTTAATGCCAAAGCTCTTTGACTCAGCT
GAAGAATTTAAAGAGCTCTTTATGATTAAGAATGAATATGAAGGAGCATAAGAGCAAATT
ATCAGATAAATTCATCGACTTCTAAGACCTTTTATGCTTAGAAGATTGAAAGTTGATGTC
GAAAAGAATTTACCAACCAAAAAGGAAATTTACTTATTTATTGGGCTATCAAAGCTTTAA
AAGCAGTTATATAAGAACATCCTTACAGGAAACATTGATGTGGTAAATGGTGTGGGTGAT
AAAATTAAACTCTTAAATGTACTTATGTAACTTAAGAAAGTTTGTAATCATCCCTATCTT
TTTGACAAAGTAGAACCTGGCCCTCCTTTTTTGGATGGAGAACATTTGATAGATAACTGC
ATGAAGTTTAAAGTCCTTGATCTACTAGTTCCGAAGCTCTTAAACCAAGGTTGCAAAATT
CTGATATTTAGTTAAATGACAAGGCTCTTAGATATTCTAGATGATTTCTTAAGGTTTAGA
GGATATCAATATTGTAGAATTGATGGTTAAACTTCTGCAAATGATAGAGAAATTCGAATT
GAAGAATTTTAAAAGGCTGACTCAACTAAGCAACTATTTATCCTTTCAACAAGAGCTGGT
GGTCTTGGAATAAACTTGCACTCTGCAAATGTTGTCATAATTTTCGACTCGGACTGGAAT
CCACAAGTTGATCTTTAAGCTATAGATAGAGCTCATAGAATAGGATAAAAGAGAGATGTT
GTAGTTTACAGATTTGTAACTGAAGGTTCTGTTGAAGAGAAAATTGTTGAAAGAGCAGCA
AGAAAATTAAGAGTAGATCATTTAATCATGCAGAAGGGTAAATTTGGAGGCGGTAATGAT
AACAACCCTAACAAAATGAATGCTTAAGAAATGCTTCAAATGATAAAGTACGGAGCTTAA
GAAATCATATTGACAGATCAGGAAGGCCAATCTATGGATGCCAATATAGACAACATTATA
GAGCATAGTATGAAAAGAACTGAAGAAATAAATAAAGAACTCAGTAAGTTGGAAGAGAAA
TTTAACTTGAATAATGTGTCTTTAACTGGTGAAGACGAAAAACAAACTAACCTTTATACA
TTTGAAGGATAAGATTATAAAAGAAAGCCATAAGTTTAAGGGAACGATCTAGATTTTATA
AATATTGGTTAGAGAGAAAGAAAGTAAATGTCCTACGATATTGATAAGTATTACAGAGAA
GCATTAAATATGCCTACTTAAACTAAAGAAAAGAAGAAGCTTAAAGGTTGGAAAGCTTCA
AATGGAGGAGGCTATGAACATTAATTTTTCGATAATGCTAAGTTAGAAGCTTTAGATACT
AAAGAATAAACGTGGAACACTTATGCATAGAATCCTGATGAATTCCTTAAAAATTTAGAA
ATCAAGGAAAAACCTCCCTAATTTACATTTAAAGATTAGCAGCAAAGAGAGAAGCTATTG
AAGTAGGGCTTTCCAAATTGGTCAAAGAAAGACTTTTTCTAATACATAAGAATGTGTGAA
ACTTTTGGAAGAGATAATTATGCAAAGATAGCAGAAGCATTCCCAACTAAAACAATAGAA
GAAGTGAAGTAATATTCTAAGGCCTTCTGGTTAAAATGGTAAGACTATATAGAGAATGGA
CAAAAATATGTTGAACGCATTGAGCGAGGAGAAGCAGAAATTTAAAAGTACAAATCAATC
GAATAAGCCATTGAAGATAAGTTTCATTATGCTTTCAAGCATTTCTTGGAAAACAACCCA
GATAAATAGCTCAAAGATTTCACTCTAAACGATCTGTCATTATTTGGATAAAAACCTCAA
CAATCCTTTAACAATTTTGAATTCTCAGAAGATGAAGACAAATTTATTGCTCTAAGCTTA
TATAAGTATGGTTACGGGTCATGGGAACTGATAAGAAATGAATTGAGAAATAATGATAGA
TTTATGTTAAATTGGATAGTGAAAACAAGAACTGTTTAAGATATCCAAAAGAGGTGTGAC
CTTTTAATTCAGAGATTTAAGAAAGAAGTTTAACTTATCAAGAAAAATGAAGAGGAGATT
CGTATCGCAAAGGAAGAGGAAGAATTGAGATTGAAAAAATAGTAAAAATCAAAGCATGAA
AGCTCTAACAAAAGCCAATCAAATAGTCGAGTTGAAATTAAAAACGTTTCTAAAAAGAAC
ATTAAAGCTATTTCATCGAAGTCAAATAGCAAGAATCTTAAAAAGCGAGGTAAATTGGAT
AATGGAATCGATGATGATTCAGAGAATTCCGAAATCGAAAATATTTCATCCTCGGATGAT
AAGAGTGACATTTCTGAATTCAGAGCTCATAAACCCAAGGCAGCCAAAGAAGCTACTTTA
TAGCAAAGTGAAGCTGTAAGAATTACAAGAAGAAGCGAACAGAAGAATCAAGAATCTTAA
AAGAATGGAAACTAAAATAACCACGTGACTCCAATTAAGAAGAGAGAAGAGAAGTAAATA
AGTAAGAGCTCAATTATTGATGTCAAATCCGCAAAGAAAAGCACAGCTCCAGTGAGTGAT
TCATAAAACTCTCATCAGCCAGTGAGAAAGAGCACTAGAAGAACTGCTTAGTGA


>Contig11737.0.g12(protein)
MQPEEYDSEYEDSESKKVVKNRGDQDVQFNHSQVSVEEEQQLIQKSKTKLEKLLCQPDIF
DTLRRINNGQIKSYDELDQNHAQNQALAQNQSRRRGNNAKNDDLEELNQTENDKLFEIQK
IEKQPDNLIGGILRDYQVEGLNWLYKLQQTKLNGILADEMGLGKTIQSIAIMALVESFKT
QEQRESRKTHHIVIVPKIVLGKWNKEIQEWVPSLRLKQFYGSNEEREIQKQEMRQHQFDI
MLTTFETVIREKGELSKYHFEFLILDEAQRIKNDESVLSQVLRKFKTQHRILLTGTPLQN
NLKELWALLNFLMPKLFDSAEEFKELFMIKNEYEGAQEQIIRQIHRLLRPFMLRRLKVDV
EKNLPTKKEIYLFIGLSKLQKQLYKNILTGNIDVVNGVGDKIKLLNVLMQLKKVCNHPYL
FDKVEPGPPFLDGEHLIDNCMKFKVLDLLVPKLLNQGCKILIFSQMTRLLDILDDFLRFR
GYQYCRIDGQTSANDREIRIEEFQKADSTKQLFILSTRAGGLGINLHSANVVIIFDSDWN
PQVDLQAIDRAHRIGQKRDVVVYRFVTEGSVEEKIVERAARKLRVDHLIMQKGKFGGGND
NNPNKMNAQEMLQMIKYGAQEIILTDQEGQSMDANIDNIIEHSMKRTEEINKELSKLEEK
FNLNNVSLTGEDEKQTNLYTFEGQDYKRKPQVQGNDLDFINIGQRERKQMSYDIDKYYRE
ALNMPTQTKEKKKLKGWKASNGGGYEHQFFDNAKLEALDTKEQTWNTYAQNPDEFLKNLE
IKEKPPQFTFKDQQQREKLLKQGFPNWSKKDFFQYIRMCETFGRDNYAKIAEAFPTKTIE
EVKQYSKAFWLKWQDYIENGQKYVERIERGEAEIQKYKSIEQAIEDKFHYAFKHFLENNP
DKQLKDFTLNDLSLFGQKPQQSFNNFEFSEDEDKFIALSLYKYGYGSWELIRNELRNNDR
FMLNWIVKTRTVQDIQKRCDLLIQRFKKEVQLIKKNEEEIRIAKEEEELRLKKQQKSKHE
SSNKSQSNSRVEIKNVSKKNIKAISSKSNSKNLKKRGKLDNGIDDDSENSEIENISSSDD
KSDISEFRAHKPKAAKEATLQQSEAVRITRRSEQKNQESQKNGNQNNHVTPIKKREEKQI
SKSSIIDVKSAKKSTAPVSDSQNSHQPVRKSTRRTAQ