Identifiers and Description

Gene Model Identifier

Contig16241.0.g102

Standard Name

SMARCA1a

Aliases

Contig16241_0_g102

Description

SNF2 family N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001376109.997093137033517e-262SNF2 family N-terminal domain
containing protein
SGDYOR304W9.997093137033517e-262ISW2 SGDID:S000005831, Chr XV
from 884514-887876, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16241.0.g102(coding)
ATGTAAGCGCAGTAACTGTACAATGAACTCAAGCGAGTCAGACATGACTTGGACAAATCA
AGAGAAGAGAAGGAAGATATGAGGGAGGAGCTTAGGGAAATGACTCAGTTATATTTGATG
ATGAAATAAGAAAGAGATAAATACCGATCACAAATGGATAATGTAAAAAAAGACTACGAA
AATATGGACAAAATAATCAAAGAAAACGTTGATAGAGCAATTAAAGCTCGAGAAAAACAC
TTCTCAGACTTGCAAAACAAGCTCAAAGAACAGCAAGAAAAGATCACACAACTTGAAAGT
CATAAAAAATGCTATTCCAATACTATCAATTACTTAGAATCTCAAATAACAAACCTAAAG
GATGAAGTATAGCATGAAAAAGAGAAAAATCAGAAGCTTTTAGCTGAAAATGAAGGCAAA
GAAAATGTGTTCCTTCAGTCAAATGGAGGGATGCTTTACGATGAAAAAAATAGGCTGAAG
TAGTTACAGTATGAGGACGAGGTGTTTATATCGAAATATAATCAAAATGAGAACTTAGAC
TAAACGAATTTTGATGATGGAGGAAGGCCTTCAGGGTTATAAGGGTAACCAGGACAAGAA
GGAGGAGCTAAGACCACTGAGGGAGACGACTGTTCTTACGACGAGGCAACAAATTGCAGG
CTCAGAGAGGAAACTCATGCTAGCATGATGTTTGGTCTGGACCCCAATTCTGCCCCAGTC
AAGCTTAATCAAATATAGTTAAGCATTAAAAATGATGGAAGTTCCAAAAAGGTTAATACT
AAACAGACCCCGGCTAAGGGTAGGGTCGCCCACTTTGATGATGATATGGATGCCTAAAAC
CCAATGTTCGATTAACCTGACAGGTTGGAAGAAACAAAAATCGGCCAGAAACACTAGAAA
GAAGCCGCAGACTTTATGCTTTCACAAGATTCAATCAAATAAATTGAAGAGGAAGCTGAG
CTCGAGACAATAGAGGAGCGCCAGAAGTTAGAGGCCATAGAAAAACAAAAACGTGAGTTC
GGTAAAGTACTCAGGCAGAGACAAGACGTGGAGTTCAAGCAACAGCAAGACTAGTCGTAG
TAAGACAGATTAAAGTATTTGCTAAAGCAGAGTGAAATTTTCACTCACTTTATTCTTTCA
CAGAAAGCAAAGCCAGGACAAAAAATAAATTCTGATGTCCCAAATTTTAATGGAGATCTG
CATTCGTTTAGAAGCAACCTTAACCAACTATCTAAGGGTCGTGATAACGGCGGGAAGTCT
TCAATATCTAAGAGACACCAGAAGAAGACCTACAGATTAATAGACGAGGACGCGGAAATA
GGAAGCGACTAAGTTTTGACTCGTTTAGACTCATAACCTTCAATTATTAAAGGAGGTTAA
CTTCGTGATTACTAGCTTGATGGTTTAAATTGGCTCATAGGTCTCTATGAGACTGGTATA
AATGGCATTCTTGCTGATGAGATGGGACTCGGTAAAACTGTGTAAACTATAGCATTAGTT
GCTTTTCTCAGAGAATTCAAGCATGTCAATGGCTATCATATTATTATCAGCCCAAAGTCA
ACTATACCTAACTGGATGAATGAATTTGCGAAATGGTGTCCCGAAGTAAGAGTTGTGAAC
CTGATTGCAAGAAAAGAATAAAGAGAAGATATTCTTAAGAACAAGTTATAGCCAGGCAAA
TTTGATGTTATAGTAACAACATTTGAAGGTTTTAGAATATGTCTTTCTAATTTGCTCAAG
TTTAAATGGGAATATCTTATCATCGATGAAGCACATAAGATCAAGAACGAAGAAAGTTAG
ATTTCCTAAAAGCTTAGGTAACTTGACTCAAGATACAGACTTCTACTTACTGGAACACCT
TTACAAAACAACCTTCACGAACTTTGGAGTTTGCTCAACTTTTTACTTCCTGAGGTATTT
AGCTCATCTGAAGATTTTGATGAGTGGTTTGATTTAAGTAAAACTAATGACACTTTGACA
GATTAAGAAAAAGAGTAGAAAAATACTGAAATCATATAGTAACTTCATAAGATCCTAAGG
CCTTTCTTGCTAAGAAGAATCAAGAAAGAAGTCGAGAAAAATTTGCCACCCAAGGTTGAA
ATACATGTTAATGTTGGTATTACTGAGAATTAGAAGTTAATTTACAGACAATTACTTAAA
AAATCAACAATTGAGAAAGGGACATCTGTTAGCTATTACAAGAATATTATTATTCAACTT
AGAAAAGTTTGTAATCATCCTTATCTATTTGATGGCTAAGAACCAGAGGGAGCTGATGAA
TTTGGAGAGCACATTATCCAGTCATCTGAAGACTATTGCATTTTCAGAGAGTATAAATAC
TGTCGTCTTGATGGTAACACTGAATTGGATGACAGAGAGAAATATATCGATGAATTCACT
AAGCCTAATTCAGAGAAGTTTATCTTCCTAATCTCAACAAGAGCTGGAGGTTTAGGTTTG
AATCTTATGACTGCAAATATAGTTGTTCTCTACGATAGTGATTGGAACCCTTAAATGGAT
CTTCAGGCTATGGACAGAGCTCATCGTATAGGTCAAAAGAAAGTTGTGAAGGTTTTCAGA
TTGATTACCTAAAACACAATGGAAGAGAAGATGATCGAAAAATAGACTGTAAAGCTGAAA
TTGGACTCTATGATTATATAGAAAGGTAGAATGGCTCCAAAGCACACAGGTGTTTAAAAG
GATGAACTTTAAGATATGGTAAACTACGGTGCAGATGAAATATTTAAAGTTGGATCAGAT
GTTCAGGAGGAGGATATCGAAGAGATGATAAGAAAAGGAGAAGAGAAAGCATATGGCATG
TAGAAAGAAGCTGAAGAGAAAGTGAAAAATAAATTTGACATGCTTGATTTTTCAATGAAT
GCTATGAATATGTATCAGTTTGAGGATGTCGACTATATATAAGAAAAAAGAAAGGAGCAA
TAGTAAACTCTCTAAAAACACATAGTAAACATGCTTAATGATGAAGTTAGGGGAGGTCGT
AGAGAAAAGAAGATGGCTTCAATGAATCTAAATGAAAGTAAACTTTTCCCTAAGTTTTTC
CAAGGTGGTGCTATTGGTGTATCAAATGAAACTAAAAAGAAGAAGCTCCTAAAGGTTTAA
GACTTTAGATTTTTCCCATAACCAGACAGGCTAAAGTATCTTCTTGAGAAGGAACTTGAT
GCAAAATATACCGGCTTTTTGCAAGGAATTGAATAAGTTCATTTTTCTGAGAAAGAAAGG
GAAGAGAAGGATAAATTATGGAGCCAAGGTTTCCCAGAGTGGGATAGGAGAGACTATTAA
AGATTCTGCTAAGCTCTTGAGTTTTGTTCACCTAATGATTATGCAGGAATTTCTTCTCAT
GTCGGTACTAAGACACCAGAAGAAGTTGAAAGGTACGCAAAGATTTTTGTTTAAAACATC
GATAACCTAACTGATGCCGATAAAATAAAAAAGAATATGGAGAAAGCTGATAAGATTATC
TCTTTCAAAACAAAAGCTCCTCAGATTATCAGAAATAAGGTTATTGCTTATGAGAGTCCC
TTAGATTAAATGGTTATCTATGCGACTTAAAAATCAAAGTATTTCTCAAAAGAAAGTGAT
ATTATTCTGATTTGCCTTACAGATTAAATTGGTTATGGCAAATGGAGAGAAATCAAGAAG
GCAATAAGAAGGGATGCAAGATGCAGGTTTGACCATCTCTTCTTATCTAGGAATGAACAA
GAATTACATAGAAGAGTAGACATTTTGGTCAAAGCTCTTGAAAAGGAAGATGAAACAAAT
AAGAAGAAGCTTGACAATACAATTGGTTTAGACGGAGACACTAATATGCTTGAAGACCAA
GAAATGAACGATCTTGATGAAGATATGGATAACTCAGAGGAAAGTAAGATTGTGGTAAAA
TCTAAGAAAAACACTAAAAAGACAACTAAAACAAAGCAACAAGTTAATCGAGATTAAACT
CTGAGCGATGAGAGCGACTAAGAGCAAGGTGATTAGATCAAGAAAGAACCTGAAGAAAAT
AAGTATAGCCACTTAAAGGATGAAGAAGACCTAGTTTTGGGTGGAGGTACAGTCCTTAGA
AATGGTTATAATCACCACAATGATGATAGTGCTAATCATCTAAGTGAAATGAAAAATCAC
AAAGAAAAAAGCAACGGATCTACTTTTATAAATGGAAATATGAAATCCAAGAACTCAAGC
AATCACGGATCCAATGGCCTTAAATAGTCTAAGCTCTAATTTAACGGCAACAATCAATAA
TTAACTGGACAAAAGAGAAACCAACCTGATGAAGATGAAAATCTTGAGAACTCGGTAAAA
GAATTAGACATGGAGGACATCTGA


>Contig16241.0.g102(protein)
MQAQQLYNELKRVRHDLDKSREEKEDMREELREMTQLYLMMKQERDKYRSQMDNVKKDYE
NMDKIIKENVDRAIKAREKHFSDLQNKLKEQQEKITQLESHKKCYSNTINYLESQITNLK
DEVQHEKEKNQKLLAENEGKENVFLQSNGGMLYDEKNRLKQLQYEDEVFISKYNQNENLD
QTNFDDGGRPSGLQGQPGQEGGAKTTEGDDCSYDEATNCRLREETHASMMFGLDPNSAPV
KLNQIQLSIKNDGSSKKVNTKQTPAKGRVAHFDDDMDAQNPMFDQPDRLEETKIGQKHQK
EAADFMLSQDSIKQIEEEAELETIEERQKLEAIEKQKREFGKVLRQRQDVEFKQQQDQSQ
QDRLKYLLKQSEIFTHFILSQKAKPGQKINSDVPNFNGDLHSFRSNLNQLSKGRDNGGKS
SISKRHQKKTYRLIDEDAEIGSDQVLTRLDSQPSIIKGGQLRDYQLDGLNWLIGLYETGI
NGILADEMGLGKTVQTIALVAFLREFKHVNGYHIIISPKSTIPNWMNEFAKWCPEVRVVN
LIARKEQREDILKNKLQPGKFDVIVTTFEGFRICLSNLLKFKWEYLIIDEAHKIKNEESQ
ISQKLRQLDSRYRLLLTGTPLQNNLHELWSLLNFLLPEVFSSSEDFDEWFDLSKTNDTLT
DQEKEQKNTEIIQQLHKILRPFLLRRIKKEVEKNLPPKVEIHVNVGITENQKLIYRQLLK
KSTIEKGTSVSYYKNIIIQLRKVCNHPYLFDGQEPEGADEFGEHIIQSSEDYCIFREYKY
CRLDGNTELDDREKYIDEFTKPNSEKFIFLISTRAGGLGLNLMTANIVVLYDSDWNPQMD
LQAMDRAHRIGQKKVVKVFRLITQNTMEEKMIEKQTVKLKLDSMIIQKGRMAPKHTGVQK
DELQDMVNYGADEIFKVGSDVQEEDIEEMIRKGEEKAYGMQKEAEEKVKNKFDMLDFSMN
AMNMYQFEDVDYIQEKRKEQQQTLQKHIVNMLNDEVRGGRREKKMASMNLNESKLFPKFF
QGGAIGVSNETKKKKLLKVQDFRFFPQPDRLKYLLEKELDAKYTGFLQGIEQVHFSEKER
EEKDKLWSQGFPEWDRRDYQRFCQALEFCSPNDYAGISSHVGTKTPEEVERYAKIFVQNI
DNLTDADKIKKNMEKADKIISFKTKAPQIIRNKVIAYESPLDQMVIYATQKSKYFSKESD
IILICLTDQIGYGKWREIKKAIRRDARCRFDHLFLSRNEQELHRRVDILVKALEKEDETN
KKKLDNTIGLDGDTNMLEDQEMNDLDEDMDNSEESKIVVKSKKNTKKTTKTKQQVNRDQT
LSDESDQEQGDQIKKEPEENKYSHLKDEEDLVLGGGTVLRNGYNHHNDDSANHLSEMKNH
KEKSNGSTFINGNMKSKNSSNHGSNGLKQSKLQFNGNNQQLTGQKRNQPDEDENLENSVK
ELDMEDI