Identifiers and Description

Gene Model Identifier

Contig22805.0.g77

Standard Name

SLU7

Aliases

Contig22805_0_g77

Description

Pre-mRNA splicing Prp18-interacting factor

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003170309.997329401607134e-86Zinc knuckle family protein
SGDYDR088C0.0000000000010000211161514907SLU7 SGDID:S000002495, Chr IV
from 619645-618497, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22805.0.g77(coding)
ATGTCTAGTTCACCACCATCAATGAACAAACCCGACTAAAAAGGTGTTGATTTGACCCAC
ATGCCCTAATATATCAAACAGGCCCCTTGGTATGTGGACTAAAAGGACAAGGAAGTTCTT
ACCCATTAAAGAGCTAGAAACGATTTGAAGAAGCCCTCAATAGATACTTGGTACAGAAAA
GGTGTTAAAACGGATCAATAAATTACCAAATACAGAAAGGGGGCTTGCACTAATTGTGGA
GCCATGACTCACACTGCGAAAACTTGCACAGAGAGGCCTCGAAAGATTGGAGCCAAATAT
AATCACAGGGACTTTGCCTAAGATGAAATCATTGAGAACATTTAATTAAACTATGAAGGG
AAGAAAGACAGATATAATGGTTATGATCCTGACCAATACAAGTAGGTCATTGAAGAATGG
GAGAGATTAAACGAAGAGCAAAAGAAGAAAAAAGAACAAGAAACTCAAGAGAAGATTGCC
AAGGGAGAGCCTATAGATGTAAGCAGTTCAGATGATGACGAGGATCCAGATATGGAGGGT
CAAAACGAAGACCAGAGTTAATTTGCAAACAAGGATCCCAGAGTAAGGACAACTATCAGA
AACTTAAGAATCAGAGAGGACACTGCCAAATATTTGAGAAATCTAGATCCTAACTCTGCT
GTCTATGATGGTAAGACTAGAATGATGAAGGAAAACCCCAATCCTAACTTACCAGAGAAC
CAGCAAGCATTTAAAGGTGATAATTATCGAAGAGTGACTGGTGATTTTATCACTCTGATG
AATCAAGAGGGATTCGTGCTTGATGCCAACTAAGTTGGAGGAGTTGAGGTTAACAACATA
GCCATGCCAAGTTAAGTTGAAATCATGCATAAGTAGTTCAGGGAAAAGAAGGAACTCCTC
AAAAACAAGAAAATGCAAGATTTAATCTCTAAGTATGGAGGAGATCAGCATCTTTAAGTG
CCCGAAGAGCTTAGAGAAGGAATGAAAGCTGAAATTGAGGATAGACTGGAAATGCAAAAG
ATGCAAAATCATTAGAAACAAGCAACAGTAGCCAAATTTGACAACAGAGGTCTTTTGGGT
GTGAAGTCTAGATTTGAAGAGGATAACTATTAAAACAGTCATTCAAGTGTCTGGGGCTCT
TACTATCATAAGCTGTTAGGATGGGGTTACAGATGCTGTTATAGTTTCGTTAAGAACGCA
AAGTGTAAGGGAGAAGAGTAGAAGAAGCAATCAATCAGACAAGAATACGATCTCGAATCT
TAAATCAAGAAACTCATTGAGGAAAAGCATAAAAGAGAAGTCGATCTTACTAACAAAAGA
CTCTTGAAGCAAGATGAAGAGTAGAAATCAATCTAAACTCAATAGGAAGAATTTAAACAT
GGAATTCAAAAACAAAACAACTACTCAGATAAAAATGAAAGTTCCTCCGATGAATCTTCA
TCTTCTTCGGAAGATGAATCATCTTCAAATTCAGGAGCTGACAGCGACTCATCTGGACCA
AGACGCAAACACAAAAAGAGACAGTAAAAGTAAAAGAGAAAGACTGATGATAAAAGCAAG
AAAGACTCCAAAAAGAATGATAAATATTCTAAAGATCAAAACAGAAAGAGCGGGTATCAT
GGAGTAATTTTGGATGATAAAGTAACAGAAGAGGAATTTGAATCTTACAGAAAATAGAGA
GATTAATTTGATGACCCTATGAGGCACTTCAAGAATTGA


>Contig22805.0.g77(protein)
MSSSPPSMNKPDQKGVDLTHMPQYIKQAPWYVDQKDKEVLTHQRARNDLKKPSIDTWYRK
GVKTDQQITKYRKGACTNCGAMTHTAKTCTERPRKIGAKYNHRDFAQDEIIENIQLNYEG
KKDRYNGYDPDQYKQVIEEWERLNEEQKKKKEQETQEKIAKGEPIDVSSSDDDEDPDMEG
QNEDQSQFANKDPRVRTTIRNLRIREDTAKYLRNLDPNSAVYDGKTRMMKENPNPNLPEN
QQAFKGDNYRRVTGDFITLMNQEGFVLDANQVGGVEVNNIAMPSQVEIMHKQFREKKELL
KNKKMQDLISKYGGDQHLQVPEELREGMKAEIEDRLEMQKMQNHQKQATVAKFDNRGLLG
VKSRFEEDNYQNSHSSVWGSYYHKLLGWGYRCCYSFVKNAKCKGEEQKKQSIRQEYDLES
QIKKLIEEKHKREVDLTNKRLLKQDEEQKSIQTQQEEFKHGIQKQNNYSDKNESSSDESS
SSSEDESSSNSGADSDSSGPRRKHKKRQQKQKRKTDDKSKKDSKKNDKYSKDQNRKSGYH
GVILDDKVTEEEFESYRKQRDQFDDPMRHFKN