Identifiers and Description

Gene Model Identifier

Contig2584.0.g90

Standard Name

SLD5

Aliases

Contig2584_0_g90

Description

GINS complex protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR489W0.000000000006001570085597868SLD5 SGDID:S000002897, Chr IV
from 1431012-1431896, Gen...
T. thermophilaTTHERM_000135400.000000000029994712494008525Synthetic lethal mutants of dp
b11-1 five fami...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2584.0.g90(coding)
ATGACACCAGCAGACTATCTATAGAGAGATTAGCAATTAAATGATGAAGAAGGTGACTTA
ATTGAGCAAGATAGCAATTTGCGCCAATTTGATTAAGCTGAAAATAGTTCATCTTTTTAT
TCTGCTTCATTCAAGGATAAATTAGTAAACGCTCAATTGCAATCTGGTTTCAATATGGGT
GAATGCAAGCAAAACTATTAAGCCATGTAGCTACAGCAATTACTTCACAATGAGAAGTCA
TCTCCAGAGATTCTACCCTACTAAGGAATTTTGGTCGACCAAATAACTAAGCTAATAAAC
CAACAAGAGATAGATGTTAATAATCCTGCCAGAGACACAGACGATAGATTCTTCTATAAT
ATTCACAGAATGGAACTAGAAAGATAAAAGTATATGCTTAAGAGTTACTTGAGAACAAGA
CTTCTCAAGATTGAGAGACATTCTATTTACATTATTGAGAAGGATCTTGCAGGACTTTTA
AGTGAGGGAGAGATGAGCTATGTCTGGAACTTGCAAGAGAACAAGAAAAGCTACTTCTAA
ACTTCTATGTTCAACAGAATACCCACAAGTTTGAATCCTTTCGAAAAAGAATAGCTCGAA
GATAGAATGATCACGTTGCCAAATGAAAAAGAGTTTGTCTTTGTAAGATTCTTCAAAGAT
CACCAACTTTATACTTTCACTAGCTTGCAAGTAGAATTACAAATCTAGAATAACTGTATA
TATTTTCTTCCTTATGATGCAATCAAAGAATTCTTAGAGAAAGGAGAGGCAGAATTACTT
TGA


>Contig2584.0.g90(protein)
MTPADYLQRDQQLNDEEGDLIEQDSNLRQFDQAENSSSFYSASFKDKLVNAQLQSGFNMG
ECKQNYQAMQLQQLLHNEKSSPEILPYQGILVDQITKLINQQEIDVNNPARDTDDRFFYN
IHRMELERQKYMLKSYLRTRLLKIERHSIYIIEKDLAGLLSEGEMSYVWNLQENKKSYFQ
TSMFNRIPTSLNPFEKEQLEDRMITLPNEKEFVFVRFFKDHQLYTFTSLQVELQIQNNCI
YFLPYDAIKEFLEKGEAELL