Identifiers and Description

Gene Model Identifier

Contig12143.0.g73

Standard Name

SKP1d

Aliases

Contig12143_0_g73

Description

Skp1 family, dimerisation domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01466 ) Skp1 family, dimerisation domain
  • ( pfam03931 ) Skp1 family, tetramerisation domain
  • ( pfam00134 ) Cyclin, N-terminal domain
  • ( pfam01245 ) Ribosomal protein L19
  • ( pfam10925 ) Protein of unknown function (DUF2680)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004263203.000745802558524e-63Skp1 family, dimerisation doma
in containing p...
SGDYDR328C3.00033207980219e-32SKP1 SGDID:S000002736, Chr IV
from 1126018-1125434, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12143.0.g73(coding)
ATGCAAAAAGTAAAGTTGGTAACCCTTGAAGGCGAGATGATCGAAGTGGAGCAGGAAGTG
ATTTCCAAGAGCGTGCTGATCAAGGGAATGATTGACGACAGCGGAGTGGAAGAAGAGATT
CCCCTGCCCAGTGTGAAGAAGAACATCCTGACCAAGATCATTGACTTCTGCTCCTACATC
AGAGACAACGCACCTCCTGAAATCGAGAAGCCCCTCAGATCCAACAACCTGAACGACGTG
ACCACTCCCTGGTATGCGGAGTTTGTGAATCTGGATCAGGAAATGCTGTTTGAAGTGATC
TTGGCAGCCAACTACATGGACATCAAGGCTCTCCTGGAACTGGCTTGTGCTAAGGTGGCT
AGCATGATCAAGAACAAAAGCATTCCAGAAATCAGAAAGTTCTTCAGCATTGAGAACGAT
TTCACACCTGAAGAAGAGGCTCAGATCATGGAGGAGAACAAGTGGGCAGAGGAGTCCTTC
TGA


>Contig12143.0.g73(protein)
MQKVKLVTLEGEMIEVEQEVISKSVLIKGMIDDSGVEEEIPLPSVKKNILTKIIDFCSYI
RDNAPPEIEKPLRSNNLNDVTTPWYAEFVNLDQEMLFEVILAANYMDIKALLELACAKVA
SMIKNKSIPEIRKFFSIENDFTPEEEAQIMEENKWAEESF