Identifiers and Description

Gene Model Identifier

Contig18346.0.g90

Standard Name

SKP1c

Aliases

Contig18346_0_g90

Description

Skp1 family, dimerisation domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004263202.9995979253168707e-35Skp1 family, dimerisation doma
in containing p...
SGDYDR328C9.000561397357242e-21SKP1 SGDID:S000002736, Chr IV
from 1126018-1125434, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18346.0.g90(coding)
ATGGAGAGCAACATTAACCAAATGCAACAAAACGTTCAGTAGGTTGAGGATAACAGGCTA
GTACAGCTTTAAACTATTGAAGGTACTATTACTGAAGTCCCAGTCTCTATAATTCAGCAT
TCTATTTTGATTAAGGGTATGATCGATGATGCAGATGTTGAAGAGGAAATTCCTTTGCCA
GATATCTAAAAGAAAACTTTGGACTAAATCATCGAATTTCTAACTCACCTGAAAGATAAC
GCAGCTCCTGACATCGAGAAGCCTCTTAGATCAAATAATTTCGAAGATGCAACTACTCCA
TGGTATGCAAACTTCATGAACAAAGACGATGACACTATCCAAGACTTGATTTTAGCAGCA
AACTACATGGATATCAAGCAACTTCTGGACTTAGGATGTGCAAAGATGGGCTGCATAATT
AGATCTCTCGATATTAAGCAGTTCAGATAGAGGTTCAACATCGTTAATGATTTTACACCT
GAGGAGGAGGCAGAGCCATTTGATGAAGATAAAATTGCTGAGTTAGCTGAATAATACCAG
AATGAGTTAAGATAGAAATAGGAGCAATAAAATGGTAATAATGATGGTTAATTGGTTTAA
TGA


>Contig18346.0.g90(protein)
MESNINQMQQNVQQVEDNRLVQLQTIEGTITEVPVSIIQHSILIKGMIDDADVEEEIPLP
DIQKKTLDQIIEFLTHLKDNAAPDIEKPLRSNNFEDATTPWYANFMNKDDDTIQDLILAA
NYMDIKQLLDLGCAKMGCIIRSLDIKQFRQRFNIVNDFTPEEEAEPFDEDKIAELAEQYQ
NELRQKQEQQNGNNDGQLVQ