Identifiers and Description

Gene Model Identifier

Contig20929.0.g68

Standard Name

SKP1a

Aliases

Contig20929_0_g68

Description

Skp1 family, dimerisation domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

  • ubiquitin-dependent protein catabolic process (IEA) | GO:0006511

Domains

  • ( pfam01466 ) Skp1 family, dimerisation domain
  • ( pfam03931 ) Skp1 family, tetramerisation domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004263209.99860868304602e-64Skp1 family, dimerisation doma
in containing p...
SGDYDR328C3.000842737734004e-34SKP1 SGDID:S000002736, Chr IV
from 1126018-1125434, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20929.0.g68(coding)
ATGATGAGATAGAATGTATCAGAGAGATAGGGAAATGTCTCAAATTAGGAAAGGTAAAAG
TCTGTGATATTATTGGTTGTTGATAAACGGGAAAATTCGTAGAATTATGTAAACAAATTA
ATCGCGACTAAAGAGTTTCACTTTGAAGAATACAACAAGATAAGTCATTTCGTTTCTCAA
AGAAGATATGTTCAAGTTTGTGTCCTTTTTGAAATTAACTATTGTATGATACTACTCTCC
CCTCTTAACCAAAATTCTAGATCTTTGAAACTCTATGCCCCAATACCCCTATCAAAGAAT
ATGTCAAAGGTTAAGCTTGTAACAAGTGAAGGTGAAATCGTGGAGGTAGATGTCGATGTT
GCCTCAAAGTCTGTACTCATCAAGGGTATGATTGATGACAGTGGTGTCGAAGAAGAGATC
CCCTTGCCAAACGTTAAGCGCACCATTCTCCAGAAGATCATTGATTTCTGCACCTACATC
AAGGACAACTCACCACCAGAGATTGAGAAGCCCCTTAGATCCAACAACTTGAATGACGTG
ACAACTCCCTGGTACGCCGACTTCGTCAATCTCGATCAAGAAGTGCTATTTGAATTGATT
TTGGCCGCCAACTACTTGGACATCAAACCACTGCTTGAACTTGCCTGCGCCAAGGTCGCA
AGTCTCATTAAAAACCGCAGCATTCCTGAAATCAGAAAGTTCTTCAACATCGAAAACGAC
TTCACTCCCGAGGAGGAAGCTCAAATCATGGAGGAGAACAAGTGGGCCGAAGAATCATTC
TGA


>Contig20929.0.g68(protein)
MMRQNVSERQGNVSNQERQKSVILLVVDKRENSQNYVNKLIATKEFHFEEYNKISHFVSQ
RRYVQVCVLFEINYCMILLSPLNQNSRSLKLYAPIPLSKNMSKVKLVTSEGEIVEVDVDV
ASKSVLIKGMIDDSGVEEEIPLPNVKRTILQKIIDFCTYIKDNSPPEIEKPLRSNNLNDV
TTPWYADFVNLDQEVLFELILAANYLDIKPLLELACAKVASLIKNRSIPEIRKFFNIEND
FTPEEEAQIMEENKWAEESF