Identifiers and Description

Gene Model Identifier

Contig21835.0.g97

Standard Name

SKIV2b

Aliases

Contig21835_0_g97

Description

DSHCT (NUC185) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR398C4.001878793042739e-150SKI2 SGDID:S000004390, Chr XII
from 919019-915156, Geno...
T. thermophilaTTHERM_006285507.002925050786358e-139DEAD/DEAH box helicase family
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21835.0.g97(coding)
ATGCTGAAGGGCAACCAAAACTTGCAGTTCGATGATATTATTACCTCTATGGAGGAAGTT
GTGACAACAGTAATGCAGAATGAAAAGCCAACTAACTTGTTGATAAATGAGACAACTAAA
TAATTGCAAGTTCCATTGATCTACAAGGTGGACAGTGATGGAGATAGAACGATTAAAGCT
CATTTTCTGCCACCTTACCAAAACAATGACCTCTTCATTGCTGATGTATTGGCCACATAC
GAGCAACAAATCAGACCATATGAGGAGCCACTTGAGGAACTGAATGAGGTTTTTGCCATA
AACACAGAAGAGATGAGTGTTAAGTATATTCAACACATTCTAGAGGAATCTATTGACCCC
AAGGAAAAGTCTCAATTCTACAAAGAAGAGCTTGAGAAGATATTTAAGGACATTGTCACC
AAGGATGTGGAGCAGGCAAGTCTCAGGTTGTCAAGCGATCAGTTGATTGGAGTTGGGCAA
TTCAATTACATCACTGGTGAAATTGATGGTTTCAAAGTTGATGTATCACAGTAAGTATTA
GATACAGTCTACTTTGACTGCTAGAAAATTAGCGATGAAGAGTTTGAAAAACTACTAAAT
GAAGTAATATTACCTGACGACACTAAGATCGATGAAAATCCCCAAATCGCTGCTTCCAGT
CTTTATGATGAGCATAAAATGATTCACGGATTCCTTGAATCTTCCAAAAAATATGTTACG
AACCCAAGGACCGACTAAGAAGAGGAAATTAATGACCTAAGAAACTTAGACATAGATCAA
ATCATGCAGAGAAAGAAAGATTAAGCTAAACAACTTAAAGATAGGCAGGAAAAGGTTCAA
GATTTGAACAAAATATCTCATCAGCCTATTTAAGATAACCTAGATCTTTCCCTTAACTAG
TTGATCGATGGCTAACAAGTTGAAGATGAGATTGATTTCATAGTTTAAGACAGTTCTCAA
CTTAGAGAAGCTCTTGAGAAAAATCAGATGCAGTAATAGCTTCCTGAGCTCAATCTGGTT
GCCTCTATGTCTACAAATTCCAATGTCATAAGTTAAGATGCTCCCTTAAGAAAACAGTGG
TATGTTATCGATGAGATAGACATGAAGAGATTCAAGGAGATGATTCCCAATCCAGCGATT
GAATACGATTTTGAGCTTGATGATTTCTAAAAGAGAGCACTTTACAGACTAGAGCAAAAC
AAATGTGTTTTTGTGGCTGCTCATACATCAGCTGGTAAGACAGTAGTAGCTGAATATGCT
ATTGCTTTGGCATTCAAGCATATGACAAAGACAATTTATACTTCTCCAATTAAGGCTTTG
TCCAACTAGAAATTTAGAGACTTCAAAGAAAAATTCACTGATGTTGGAATTAAAACTGGT
GATGTAACTTTGAATGGAAGTGCCTCTTGTGTTGTCATGACTACTGAGATCTTGCAGATG
ATGCTCTACAATGAATCAGATTTCTTAAAGGATGTTGAATGGGTTATATTCGATGAAGTC
CACTATATAAATGACTTTGAACGTGGAACTGTTTGGGAAGAAATCATCATGAAATTGCCT
GACCACATCAGTTTTGTCATGCTTTCAGCTACTGTACCAAACTACAAAGAATTTGCAGAT
TGGGTAGGCCGCACTAAGAAGAAGGAAATATACGTTCAGATGACAGAAAAGAGACCTGTA
CCACTTCAGCATACTCTTCTCTACAAAGATAAGTTCAGTGTGATCAAGGATGAGTTAAAC
AACATGAATAGAGATTCCTTAAAGAAAATCTTGTAAGAAGAGAAGAAAGATTCATTCAAA
ATGAGAGATGAAAAAAATAAAGGGATTAAACCTAAAGAAGAAAAATAGGAAGAGGCAAAG
TTTGAGAAGAAAAAGGAGATAGACTTTAAAGAAAAAGCTTTAAAAGCTAAGGAGAATCAA
ATAAAGAAAACCGCAATGAAAGCATAAAAAAGTGGAGGTAATGGAGGAGGTGGTTAAGGC
CCAAACTCACAAAACAAATCAAACAAAAAGTATGAAAAGTTCCACAAGTATTTGATATCT
ATTTCAAGAGATAAACTTTTGCCTTGTGTTGTGTTTTGTTTTTCAAGAGCAGCTTGTGTT
GAAATACCAAATCAGCTTCAAGAATCCCTGGAATTTACAACTGGATAAGAAAAGGGAGAG
ATTAAGAAATTCTTGAAATCTAAACTTTAAAGATTGAATGAATCTGACAGAAACTTGCCA
TAAATTTAGAACATTAAAAGTTTGTTAATCAGAGGTATTGGTTATCATCATGCTGGTATG
CTACCAATAGTTAAGGAAATCGTTGAAATTCTGTTTGCAGATGGTTACTTGAAAGTTATA
TTTGCCACTACAACATTTGCTATAGGACTTAACATGCCAGCAAGAAGTGTCATGTTTACT
TAACTTTTCAAGTTTAACGGCACAGAAAGTTTGATACTTGAAGCTAGTGAGTATTTACAA
ATGGCTGGAAGAGCTGGTAGAAGAGGAAAAGATACAACTGGAACTTGTATATTAACTCTA
GACAGAGCTTTTGGTAAAGTACCAGATGCTGAAGAGTTTGAAGAAATTTTGACAAGCAAA
GGTACTCATCTTGAGTCTAAGTTAAAACTCAGCTATCAAATGGCATTGAATGTAGTTAAA
TCCGAAGATGTAATGATTAACGATCTTCTCAAGCTTTCATTCTTTGAAAATGAAGCAGAA
AAGGAAAGACAAAAGGCAACCGTCAAAGCTTAATGGCTTTAGGTTAGAATTCAAAGAGCT
GAACATTTGGAATGTGTTTAAGTTTTGTCGCCAAAATACTTCTTTGAAAAAGTTGTTGTG
CTTTAATAACTAGAGAAAAATCAAGAGGATTTCTTATGTTTGCTTATCAGAAACAATCAA
TACAAACCTGAGATATACAATGATGAAGAAGAAGCAAAGGACTAAAAGAAATCAAGTGGT
GTTTTTGGCAATTTTTATTATGAATATGTTAGAATAAGCCCTGCAAATGTCTTTAGAATT
TATGAAAACTTCGCAGAAATCGGCTATAAACTTACCCTACATCAAGAAAGACTTCCTGAA
AGACCTCTCAAGGATATTATAAGTGTAGTTTCCAAGTTTTAAGTCTTCAAGGATTGGAAA
TTAAGCCCAGCTTGCAATTCTTACATTAAGGATAAGTAGAACCATATGGAAACTCTAAGA
ACATTGCCTTGTTTTTAATGCAATTTAGTAATCAAGCATCTTGGCTAAATTGAGGCTCTT
AAGAAATACGAGAGTGAAATGAGATAGTGTAAGGATTTGATGGGAGCAGGAGGGCAGGAA
AAGCTTGATGATTTCAAAGCCAAAGTTCAGGTACTTATTCACTACAAATACATCGACTAC
GAATTGAATATGCTGTTCAAGGGCAAAGTTTCAGAGTTGATTACCAACAATAAGTTCTTG
CTTACAGAATTGATTTTTTCTGGATTGTTAAAGGAGCTTAACAACGAAGAGATTATTGCT
CTACTGAGTATTTTGGATACTTAAGTCGGAAACTCAAAAGCCGATGAATCAGACGCTTTC
ATCAGTGAGACTTTCCAAAAGGCTGTTTCTTTCCTTAACGAAGAAGCCTTGAAACTTATC
GAAGTGGAGGGCAGGTTTGGAGTTCAAGATGCAGTCAGTGAAATCAGCAAGTACCTCAAT
TTCCAATTCTACGAACTACTTTTTGAGTGGGCCAGCTAGAAACCTTTCGTTGAGATAGTG
AAGATAGCAGCAGTTTCAGAGGGAGATGTAGTTAAGGTCGTACAAAACGTAGAGAGACTC
CTGAGACAAGTGAAAAACGCTTCTAGAGTAATTGGAGATGCACAACTTGCAGAGAGGATG
GATCAGTGCACACTGCTTATCAAGAGAGACATTATCTTCACTCCAAGTCTCTACTTAGAG
TGA


>Contig21835.0.g97(protein)
MLKGNQNLQFDDIITSMEEVVTTVMQNEKPTNLLINETTKQLQVPLIYKVDSDGDRTIKA
HFLPPYQNNDLFIADVLATYEQQIRPYEEPLEELNEVFAINTEEMSVKYIQHILEESIDP
KEKSQFYKEELEKIFKDIVTKDVEQASLRLSSDQLIGVGQFNYITGEIDGFKVDVSQQVL
DTVYFDCQKISDEEFEKLLNEVILPDDTKIDENPQIAASSLYDEHKMIHGFLESSKKYVT
NPRTDQEEEINDLRNLDIDQIMQRKKDQAKQLKDRQEKVQDLNKISHQPIQDNLDLSLNQ
LIDGQQVEDEIDFIVQDSSQLREALEKNQMQQQLPELNLVASMSTNSNVISQDAPLRKQW
YVIDEIDMKRFKEMIPNPAIEYDFELDDFQKRALYRLEQNKCVFVAAHTSAGKTVVAEYA
IALAFKHMTKTIYTSPIKALSNQKFRDFKEKFTDVGIKTGDVTLNGSASCVVMTTEILQM
MLYNESDFLKDVEWVIFDEVHYINDFERGTVWEEIIMKLPDHISFVMLSATVPNYKEFAD
WVGRTKKKEIYVQMTEKRPVPLQHTLLYKDKFSVIKDELNNMNRDSLKKILQEEKKDSFK
MRDEKNKGIKPKEEKQEEAKFEKKKEIDFKEKALKAKENQIKKTAMKAQKSGGNGGGGQG
PNSQNKSNKKYEKFHKYLISISRDKLLPCVVFCFSRAACVEIPNQLQESLEFTTGQEKGE
IKKFLKSKLQRLNESDRNLPQIQNIKSLLIRGIGYHHAGMLPIVKEIVEILFADGYLKVI
FATTTFAIGLNMPARSVMFTQLFKFNGTESLILEASEYLQMAGRAGRRGKDTTGTCILTL
DRAFGKVPDAEEFEEILTSKGTHLESKLKLSYQMALNVVKSEDVMINDLLKLSFFENEAE
KERQKATVKAQWLQVRIQRAEHLECVQVLSPKYFFEKVVVLQQLEKNQEDFLCLLIRNNQ
YKPEIYNDEEEAKDQKKSSGVFGNFYYEYVRISPANVFRIYENFAEIGYKLTLHQERLPE
RPLKDIISVVSKFQVFKDWKLSPACNSYIKDKQNHMETLRTLPCFQCNLVIKHLGQIEAL
KKYESEMRQCKDLMGAGGQEKLDDFKAKVQVLIHYKYIDYELNMLFKGKVSELITNNKFL
LTELIFSGLLKELNNEEIIALLSILDTQVGNSKADESDAFISETFQKAVSFLNEEALKLI
EVEGRFGVQDAVSEISKYLNFQFYELLFEWASQKPFVEIVKIAAVSEGDVVKVVQNVERL
LRQVKNASRVIGDAQLAERMDQCTLLIKRDIIFTPSLYLE