Identifiers and Description

Gene Model Identifier

Contig19419.0.g47

Standard Name

SKIV2a

Aliases

Contig19419_0_g47

Description

DSHCT (NUC185) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam08148 ) DSHCT (NUC185) domain
  • ( pfam13234 ) rRNA-processing arch domain
  • ( pfam00270 ) DEAD/DEAH box helicase
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam08542 ) Replication factor C C-terminal domain
  • ( pfam12073 ) Protein of unknown function (DUF3553)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003161809.997093137033517e-262DEAD/DEAH box helicase family
protein
SGDYJL050W9.997093137033517e-262MTR4 SGDID:S000003586, Chr X f
rom 342522-345743, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19419.0.g47(coding)
ATGAACAAAAAGAACGCAAAGTTAGATTAGATGTTTGCTGGCTTCAATGCAGTTGAAGAT
TCTGATGTGAATGATTCCAATGATGAGGAAATGCAGGTGGACTCAAAGCAACAGAACAGC
AATAACAACTCAGCTGGAGGTGACATCAACAAAAAGAAGAAGAAAAAGAACAAAAAGTCA
GGAAAAGCCAAGAGAGAAGCTGAACGCAATCTCACTGAACTCGAGCAGTAAATAGCCAAC
AAAGATTCTCAAAAGAGATAGAAAGCAGACAATGTAAATATGGGAAGCGAATAGGTCAAT
ACTGAGAAAGATTACTTTGATGAAGAAGAGGAAGAGAGATTGGCTAAAGAAGCAGAAATG
ATTGAGAAAGTCATTTAGATCGAGTAGAACATGGATTAAGTTGGCTATAATGAGGAAGAT
TACGAGGTTGAGAGAATGGAATGGCCTAATTGCATACATGAGTACGTTCAACCAAAGGGC
TATGATAGACCACCCTACAAGAGACCAGCTAAAAGGGCAAAGGAATACAAATTCACCTTG
GATAAGTTTTAGGAGAGAGCAGTCGAATGCATCGAGAGAAATGAGTCAGTCCTAGTAGCC
GCTCATACATCAGCTGGTAAAACTGCAGTAGCAGAGTATGCCATTGCTCTTGCTCTTAAC
AGCAAGCAGAGGGTTATCTATACCTCACCTATTAAAGCCTTGAGTAATTAAAAGTACAGA
GAATTGTAAGAGGAATTCGTGGATGTAGGGCTTATGACTGGTGATGTTACCATTAATGAA
TCAGCTTCCTGTATAGTAATGACCACTGAAATTCTTAGAAGTATGTTGTATAATGGTAGT
GAAATCACAAGAGAAATGGCCTGGGTCATTTTCGATGAGGTCCATTATATGAGAGATAAG
GAAAGAGGAGTCGTTTGGGAAGAGACAATGATCCTACTTCCAACAACTGTCAAGTATGTA
TTCTTGTCTGCAACTATTCCCAATGCTAGAGAGTTTGCTGAGTGGATCGTGAAAATAAAG
AAGCAACCTTGTTCAGTTGTATATACTGACTACAGACCCACTCCACTCCAGCATTTCATC
TACCCCATGGGAGGAGAGGGTATATACTGTGTGGTTGACTAAAACGGTCAGTTTAAGGAG
TAAAATTTCACCAAAGCAATTAGTGTACTCGAAAATGACATGAACTTAGATAAGATTCTT
GATGATAAAAAGAATAGAAACAAGACCACCTAGTAGAAAACTACTTAAAACTCAGAAATG
AAGAAAATCATCACACTTATTGTAGATAAGGGACTAGATCCATGTATTGTTTTCAGTTTT
TCAAAGCGTGACTGCGAAGCTTATGCTATGGCTCTTAAGGGTTGCGATTTCAATAAAGAT
GAAGAAAAGGACCAGATTAAGCTTATTTTCAATAATGCAATGTCCTCATTAGCAGAGGAA
GATGCTCAACTGCCCACTATTCAATCAATGTTGCCCTTATTATAAAGAGGTATTGGTATA
CATCATGGTGGTCTGCTTCCTATAGTCAAGGAAGTCATTGAGTTACTCTTCCAGGAAGGT
CTCTTAAAGATTTTATTCACTACTGAGACTTTCTCAATGGGTATCAACATGCCTGCTAGA
ACTGTAGTTTTTACGTCAATTGAGAAATTCGATGGTGATGAGTACCGCTGGATTACAGGT
GGTGAGTTCATTCAGATGTCCGGGCGTGCTGGTCGTCGTGGCTTAGACGATAGAGGAGTC
ACTATCATGATTGCTAATAAGAAACTCGAGCCTGATGTTGCTAAGAACATTCTCAAGGGA
TAGAGTGATCCACTTTACTCTGCTTTTCATTTGGGATACAACATGCTCTTAAATATGATG
AGACTTGAAGATATTAGTCCTGAAGATATCATCCTTAAGAGTTTCCATCAATTCTAAAAT
GAAAGAGCTTGCCCTCAGATGAAAGCCAAACTCACTGAATTAATAGCTGAATATAAATCA
ATCAACATTCCACTAGAAGATAAATATGAGAAGAAAACTAAATATATCAGTCAGAGACAG
TAGATTGACTAGAAAATTAACACAATTGTATGTGAACCAGAAAATATCATGCCATTTATG
GTCCCAGGCAGATTGGTTAAGATATGTTCAGAGCAGTAAGATTGGGGTTGGGGTATTGTA
GTAAGCTGGACTAAGCAAAAAATTAATCCCAAGAAGTTTATGATGGCAGCCAAGAGTAAA
ACCAGCCAGGCCTTAGACATTCTATCTTAGAATGAAAACCACTTCATCCTTGATGTCTAC
CTCTATGTGAAGAACAGATTGACAAATGACAATTTATTGCAGCCAGGTGACGCCAAAGCT
AAAGACGGCAGATTGGGAGTATGCCCAGTTATCATGCATCACACCAACATAGCTGCCATT
AGTACTATATAGGTAAACTTACCACATAACCTCAAGGACTAAGATAACGCCAAGCAAGTT
GAGAACATGTTCTTCTAAATAATGCAGAGATTCGAGTTTGGTGCAAAGATTCCCCTGTTA
GACCCCATCAAAGATATGGAAATTGAGAATTCAGAGCTTAAGAAATTTTTCAAAGCGAAA
ACTCTAATTGATAATGAACTTCAAAAGATCAATGAGAAATACTTGCAGAATCAATCAGTA
TCAGATCAACATGAGATATTATTTGCAAGAAAGAAAGAGATAAAACATACAATGACTGAG
TTAGAAGAAAGTGTAAAGAAAGCCAGTGAGATGATCATGAAGAACGACCTAGTTAACATG
AAGAGAGTTATGAGAAGACTAGAGATGTGTGAGAAAACTGATTAACCAACACTCAAAGGT
AAAGTTGCCTGCTCCATTTCAGCAAGTGATGAGCTCCTCGTTACAGAGCTACTCTTCTCA
GGTATGTTCCAAAACATGGAACCTAATCAGATTGCAGCACTGTGCTCATGTTTAGTATTT
ACAGATGTAAAGGGGGAGGTCAAAATGCCCAAAGAAGAGAAGTTTACTCAGCCATTTTAA
CTACTGCAATAAGCAGCTGAGAAAATTGCCACTATTATGGTTGAGAGTAAAATTCCATTA
GACAAGGAAGAGTATGTACAGAAGTTCAGACCAGACATAATGGAAATCACTTACAAGTGG
TGTTAGGGAGCCAAATTCAAGGAAATTTGTGAAATTGCACAGGATGTATATGAAGGCACA
ATTATTAGAGCTTTCCGTAGATTAGACGAATTACTTAGTCAAATGACAGAGTCTTGCAAG
ATTATTGGAAATATGGAGTAAAAGAGAAAGTTTGAAGAGGCTCAAAAAGGTCTCAAGAGA
GGTATTGTGTTTGCAGCATCACTTTATTTATGA


>Contig19419.0.g47(protein)
MNKKNAKLDQMFAGFNAVEDSDVNDSNDEEMQVDSKQQNSNNNSAGGDINKKKKKKNKKS
GKAKREAERNLTELEQQIANKDSQKRQKADNVNMGSEQVNTEKDYFDEEEEERLAKEAEM
IEKVIQIEQNMDQVGYNEEDYEVERMEWPNCIHEYVQPKGYDRPPYKRPAKRAKEYKFTL
DKFQERAVECIERNESVLVAAHTSAGKTAVAEYAIALALNSKQRVIYTSPIKALSNQKYR
ELQEEFVDVGLMTGDVTINESASCIVMTTEILRSMLYNGSEITREMAWVIFDEVHYMRDK
ERGVVWEETMILLPTTVKYVFLSATIPNAREFAEWIVKIKKQPCSVVYTDYRPTPLQHFI
YPMGGEGIYCVVDQNGQFKEQNFTKAISVLENDMNLDKILDDKKNRNKTTQQKTTQNSEM
KKIITLIVDKGLDPCIVFSFSKRDCEAYAMALKGCDFNKDEEKDQIKLIFNNAMSSLAEE
DAQLPTIQSMLPLLQRGIGIHHGGLLPIVKEVIELLFQEGLLKILFTTETFSMGINMPAR
TVVFTSIEKFDGDEYRWITGGEFIQMSGRAGRRGLDDRGVTIMIANKKLEPDVAKNILKG
QSDPLYSAFHLGYNMLLNMMRLEDISPEDIILKSFHQFQNERACPQMKAKLTELIAEYKS
INIPLEDKYEKKTKYISQRQQIDQKINTIVCEPENIMPFMVPGRLVKICSEQQDWGWGIV
VSWTKQKINPKKFMMAAKSKTSQALDILSQNENHFILDVYLYVKNRLTNDNLLQPGDAKA
KDGRLGVCPVIMHHTNIAAISTIQVNLPHNLKDQDNAKQVENMFFQIMQRFEFGAKIPLL
DPIKDMEIENSELKKFFKAKTLIDNELQKINEKYLQNQSVSDQHEILFARKKEIKHTMTE
LEESVKKASEMIMKNDLVNMKRVMRRLEMCEKTDQPTLKGKVACSISASDELLVTELLFS
GMFQNMEPNQIAALCSCLVFTDVKGEVKMPKEEKFTQPFQLLQQAAEKIATIMVESKIPL
DKEEYVQKFRPDIMEITYKWCQGAKFKEICEIAQDVYEGTIIRAFRRLDELLSQMTESCK
IIGNMEQKRKFEEAQKGLKRGIVFAASLYL