Identifiers and Description

Gene Model Identifier

Contig15304.0.g55

Standard Name

SKI6

Aliases

Contig15304_0_g55

Description

3' exoribonuclease family, domain 1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01138 ) 3' exoribonuclease family, domain 1
  • ( pfam03725 ) 3' exoribonuclease family, domain 2
  • ( pfam04686 ) Streptomyces sporulation and cell division protein, SsgA

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006915002.998863950472602e-383' exoribonuclease family, dom
ain 1 containin...
SGDYGR195W1.0002124404074584e-26SKI6 SGDID:S000003427, Chr VII
from 888882-889622, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15304.0.g55(coding)
ATGTTAGAACTGCGCCATGATAATGATGAGAGTACTCTCAGAATGAATGGTAGAAAATTA
CTAGAAATAAGAGACATAAAATGTCAATTAGGTGTGATGAAAAACACAAGCGGCTCTGCT
TTATTTGAGATTGGAAACACTAAAGTAGTCGCATTTTTACAAGGCCCTCATCAAATTACA
CAGAGATAAGCCCAGTCTCTTGGTGTGAATTAATCAAACAGAGGAATACTCAATGTTAAC
TTTTTCGTAACTAACTTCAGCGCAATTGAACATAGAGCTGATGTCAAAAAGGATGCAAAA
ATGAAAGAATTCACTAGAATGATTAAGTCAGTGTTTGAGTAGGTCATTTAACTCGACTTA
TATCCTCGCTCTCAATTAGATTTGCAGGTTTTTGTTTTGGAATCTGATGGTGGTTATAGA
TCAGCAGCTTTCAACGCTGTATCTATGGCTCTTATGGATGGTGGTATTGCTATGAAAGAT
TTCGTGGTAGCTACCACTGCTGGTCTGCTTGGAAATGTAGGAGTCATTGACCTCATTTAC
CAAGAAGAAAAGAAATAGAATTGTGAATTCGTACTCGTTCACTTACAAAAAGCACAAAAA
ATAGCATATGTCAACTTAAATTGCAATAAGATTCGTTTGAGTGATTTTGAAAAGCTAATG
AACATCAGCATTTAATCATGTGATTAAATTGCAAATACCATGAAGAAAGCAATCAGAGCA
AAGTTAATAAACAATATCAATAGCTTTTATTTCAAGTGA


>Contig15304.0.g55(protein)
MLELRHDNDESTLRMNGRKLLEIRDIKCQLGVMKNTSGSALFEIGNTKVVAFLQGPHQIT
QRQAQSLGVNQSNRGILNVNFFVTNFSAIEHRADVKKDAKMKEFTRMIKSVFEQVIQLDL
YPRSQLDLQVFVLESDGGYRSAAFNAVSMALMDGGIAMKDFVVATTAGLLGNVGVIDLIY
QEEKKQNCEFVLVHLQKAQKIAYVNLNCNKIRLSDFEKLMNISIQSCDQIANTMKKAIRA
KLINNINSFYFK