Identifiers and Description

Gene Model Identifier

Contig11428.0.g42

Standard Name

SIRT5b

Aliases

Contig11428_0_g42

Description

Sir2 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008593301.9992362000979228e-56transcriptional regulator, Sir
2 family protein
SGDYPL015C0.0000000000000700196834671948HST2 SGDID:S000005936, Chr XVI
from 526883-525810, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11428.0.g42(coding)
ATGGAAAAACTAGCTAAAGCTATAAACATACATTAAATTTGTGCTCATTTTATCAAGAAC
TCCTAAAATTTGCTAATCACATCTGGAGCTGGGATGGGGGTTGATTCAGGACTTCCTGAT
TTCAGAGGACCAAACGGTTTCTATAAAGCTTATCCATATTTCAAATAAGTTGGAATGAAA
TTTGAGGATGCAGCTAGTCCTTCATTTTTCAAATAAGACCCCAAGAAGTATTGGTACTTT
TATGGACATAGATTTAAGACATACTAGGATACTATTCCAAATGAGGGATTCACTAGGCTA
CTTGAATGGTCCTAGAAGTGCTTACAAAAGAGTGATAAGAAAGATGCACCAAATCATTTT
ATCTTCACTAGTAATGTAGATGGGTAATTCTAAAAAGCAGGTTTTTCTGATTAAAATGTA
GTTGAGGCTCATGGAACTATACATAAATTCTAATGCGATAAATGCGATATTATTGAGGAC
AGAAGGACAGAGTAAATTCAACTAGACACTGTAAAGTATGAAGTAGTAAATATTCCAAAA
TGCCTGAAATGTGATCAAATAGTGAGACCTAATATCTTGATGTTTGGTGACAACTCCTGG
CTTTCCTATGATGTTGACTAAAAAGTTTCTAACTATACGAAATGGTTAAATTAAATCATT
AATGAGTCTTTAGTTATAATTGAAGTCGGTGCTGGTTCTGCTATTCCCACAGTAAGGATG
TCAAATGAGATGGTTCTGGAGCAAAGAATAAATAAAAACACTATGCTCATAAGAATCAAT
CCAAGTGAACTATAATACTTCAATGTTAAGTAAGATACTATTTCTTTGACAGAATATGAT
GTTGAAGAATTGAAATTACATAAAATAGATGAAATTCTTTAAGATCAAAAATATTACATT
GCTATTGGTGAAGGTGGAAAATCTACTCTTAACAAAATTAATGAGTATTTAATTTGA


>Contig11428.0.g42(protein)
MEKLAKAINIHQICAHFIKNSQNLLITSGAGMGVDSGLPDFRGPNGFYKAYPYFKQVGMK
FEDAASPSFFKQDPKKYWYFYGHRFKTYQDTIPNEGFTRLLEWSQKCLQKSDKKDAPNHF
IFTSNVDGQFQKAGFSDQNVVEAHGTIHKFQCDKCDIIEDRRTEQIQLDTVKYEVVNIPK
CLKCDQIVRPNILMFGDNSWLSYDVDQKVSNYTKWLNQIINESLVIIEVGAGSAIPTVRM
SNEMVLEQRINKNTMLIRINPSELQYFNVKQDTISLTEYDVEELKLHKIDEILQDQKYYI
AIGEGGKSTLNKINEYLI