Identifiers and Description

Gene Model Identifier

Contig13404.0.g82

Standard Name

SIN3B

Aliases

Contig13404_0_g82

Description

Sin3 family co-repressor

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004509502.000130478826482e-26Ubiquitin carboxyl-terminal hy
drolase family ...
SGDYOL004W6.9997332827772725e-22SIN3 SGDID:S000005364, Chr XV
from 316938-321548, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13404.0.g82(coding)
ATGAGTAGTACTTACGCTTAAGCAACTCTAGGGACTTCTGGTCCTTCAGGCCCAGGTGGT
CTTGGACCAGCAGGTCTATCTGGAAAAGGTGCATTATAAAATTCAATTTCAGTGATGTTT
ACCCCTGAGGAAGAATTGACGATAAGATCTAAACTCTCTGAGTTCATGCTAAATGCAAAG
AGAACAATGAATGAGGAGGACTATCGCAACTTCAAGCAAGCCTGCTTCACATCATCAACA
ATGCTAACAGATGTGAGTCAGGGTCTCAACATTCTAAATGAAGTGATAAAGAATTACGTC
AATTTAAAGAAAGAATTGAATGAATTCCTCCCGGAAAGATTCCAGTTTGAAATGCAAGAT
ATCGTTAATATGAATTAAGCAGTCGATTTCTTGAAAGAGGTTAGGTAAAAAGTTGATGAT
TAAAAATATTCAATCTTTGTGACCGCCTTGAGAAGACATGAATAACACGATATCACATTA
GATCAAATGAATGATATAATTTATGACATGCTCAAAGACTATCCAAATCTCTAGCAATAG
TTCAAAAAGTTTATTGAAAATGATAAGGCTTAAGAACAGATGTAGCAGTAGTAGATTTAA
CAATAGCAATAAGTGGAGAGTTAAATACAACAATAAAAGGGCAAGAAAACATTTGGGAAG
AAAGCTCAAGAGCCTGAAAAGATTGTCCAATCATTAATCAAGCCTGTTTAAAGGCCCGGA
GTTATCAAGCCATAACCAAACAGAGGACCTACTAGTTAAATGGGAGAAGAAATACAAGAA
TACAGTGTCCCAAGAATATAAACTCCAATCGCAGGAGGAGCATTTCATAGTTAATTGAAG
CATCTTCCAAAGACAGAATATTCGTTTTTCGACAATCTTCGTAAATTAATAAGGGATGAA
TCCTACTATGAAGATATTATGAAGTGCTTCTACTGTTACATAGAGGGTGTTTTCAATCAA
AATGAGCTTTTTGATCTTGTGACACCACTCTTTGACAAACAAAATGAAGATTTACTGAAC
TCTTTTAGAGCTCTTATAGCTTCCAGAGACAACTCTAGACGCCATCATAACTTACTTTGC
AAACCCTTCTCTGAGTTTGAAACTCATTTTTTCAGAAAAGTTTCCTACTCTTACTTTGAA
ATGCCAGTGGACTTTCCCAGACCACTCTGCAAAGGCAGATTTATTTACCCAGAAATTAAG
CAATTATGCAAGGATATCTTCAATGAGGACTACTCCAGTTTACCTTAAGGATCCGAATCT
TTTAAGTTCAAAACCAAGAATTAATACGAAGATGCCCTATTCAGAGTGGAAGATGATATG
TACAAAATGGATTTTGAAATTGGTAACATACACAAAACAATGAAAGTCCTTCAAGAAGAA
AAGGCTAAAATAGAAGATATGAGTTTGAGTGAGAAAGAGCAATTAAAGCTTGATGAGAAA
AAATTCAACAAGTTAAGACTTAAATAGATTGAAAAAATCTATGGTGAGCTTGGTCAAGAA
ATGTTAAGACTACTGCCTATGAACCCAGCTAGAGCCATACCAATTATATATGATAGATTC
AGAAACTCTTACGATAAGTACGTTGATGAAAAGAGAGACTACTTGAGACAGTGGAGAGAT
ACTTGTGAGAAGAATTTCTAAAAATCACTTGACCACAGAAGTTTTCACTTCAAATCATTT
GAGAAGAAGAATCAATCCTCCAAAAACTACCTTCTTGAGATCAAGAATTTATCATTAATG
AGTAACAAGCATAAGAACCACAACTAATTGTTGGGTGGTAGCAAGAATTGTGAAATCTAT
GGTACTTATTCACTTTTTGAGGCTATCGTAGTTCATCAATAGACTCATCTTCAAAATGAG
AACATTTTGAATGACTACCCAATAAATCTAAAGGACTCAGATGAAATTCTCAGCTCAAGA
ACTGAAAAACTACCACAAATGCGCTTCTTGTTTAATGACAAAGAAGTCTTTTAACTTGCT
TGTGAAATTATCTTAATTGGTATCAGATCAGCTAGTAATGGCAGCATCGAGAAAGACAAG
ATGAGAGGATCTCTAAGAGCAATAGTGGAAGATTTCATGAATGTTAGCAACTTCGATGAG
ATCTTGCAAATTTGCCAAAACATTAATTACTTAGATGAAACCAAGGCTGACATAATATGC
TAAAAAGACTACTATGAATTGAAAGTTACTGATGAATTTGAGTACTAGAGAAAACCTGTA
AATGAGTCAAAGTAAGAAGATGAACCAATGGATGAAGAAAAGAAAAATAGCGATGCCAAA
TTAAAGGAGTAAGCGAAAGAAGAAAAGAAAGAAGGCCTCTAAACTTCCCCAGACAACGGA
GCCAAGAAAGCCCTCTCTCTATCTTAGCAACTAAAGCCCATTACAGTTTAGAGTTTTAAA
ATCGATGAGAAAGACATAATTAATGAGTCAGTTTTCTATCCATATTTCAAGCCAGACTAT
AAGCTCATGTACGGCTCTCAGAACTTCTATGTGATTTTGAGGTAAATTTACACCATTTAT
GAGAGAATCTTGAAAGCAAAGCAAATCATTGATGCTAAAGTTGAAGAGGATATACTAAAC
CACTTCGAAGAATATCAACAGCATCTCCTACCAAGACTTAACGAAATTAGATAGGAAAGA
TTTGATGTATTCCTTGGTGGTGTAATTTTGGCTATGCAAACAGGATCAGATTTCAATAAA
TACGAAGACTTCGCAAGAGCACTTCTTGGTAGCAAGGCTTACTTGCTCTTCTCATTTGAC
AAGCTTATTGTGTAAACTGTAAAGTAACTCTTAAGCATTGCTAATGATGATTCCAGTCAG
AAGAGCTTCAAATTATCCCAACGATTCCAATCTAATATTGAAAGCATCAAGTCTGAAGAG
CCCAGTGAGCAATGGAAAAATGAGTCAATTTATCTGTCTAATTTCGCAAGTACAATGCAA
GAAATCAACAATTTCAATGGGTATGGAGTGAGACTACTATATAGTCCCAAGTCTTAGATT
CTATCCATCCATTATTTCACTATTAACCCTTATCAATTCGCAGATAAAAAGCATATCAAT
GAGAACTTGAGCTACACTGAGAATGCAGTGAACTATCCAATTGATGCAAACGATGTCCCA
TACTGTTCTACTATTTTCATGAGAAGAATGAAGAATTTAGGGCTACGTCATAGACCAGAT
CTGCTTATATCCTAAGATAGCATCCATACAGAAAACAACTTAGTTCATAGAATTTAACCA
TAGACTTTCAAGCTATACTATGGAAATGAAAGTGAGGATGTCATGATTTACAAGAGAAAA
TCTAAGCTTAATGTTGAGGAGGAGTTCTTAACAGATTTCATGATTTAAGCTAAAACAAAT
GATATCAAGCGCAGATGTTTCGAAAAAATCAGTTAAAATTCCATTATACCAGGCAACAGG
GACTACTCGGCAATTAGAGATGCAAACATGATGAGCACTCTCAGCAACAATAGATAAGTT
TAACCCAATAGTGACTAGAGATAAATTTAATATAACTCAGCTGTATTTGAAAATGAAGAG
GATCAGCCCATGGCGAACGACGCAAATAACAAAGATTGA


>Contig13404.0.g82(protein)
MSSTYAQATLGTSGPSGPGGLGPAGLSGKGALQNSISVMFTPEEELTIRSKLSEFMLNAK
RTMNEEDYRNFKQACFTSSTMLTDVSQGLNILNEVIKNYVNLKKELNEFLPERFQFEMQD
IVNMNQAVDFLKEVRQKVDDQKYSIFVTALRRHEQHDITLDQMNDIIYDMLKDYPNLQQQ
FKKFIENDKAQEQMQQQQIQQQQQVESQIQQQKGKKTFGKKAQEPEKIVQSLIKPVQRPG
VIKPQPNRGPTSQMGEEIQEYSVPRIQTPIAGGAFHSQLKHLPKTEYSFFDNLRKLIRDE
SYYEDIMKCFYCYIEGVFNQNELFDLVTPLFDKQNEDLLNSFRALIASRDNSRRHHNLLC
KPFSEFETHFFRKVSYSYFEMPVDFPRPLCKGRFIYPEIKQLCKDIFNEDYSSLPQGSES
FKFKTKNQYEDALFRVEDDMYKMDFEIGNIHKTMKVLQEEKAKIEDMSLSEKEQLKLDEK
KFNKLRLKQIEKIYGELGQEMLRLLPMNPARAIPIIYDRFRNSYDKYVDEKRDYLRQWRD
TCEKNFQKSLDHRSFHFKSFEKKNQSSKNYLLEIKNLSLMSNKHKNHNQLLGGSKNCEIY
GTYSLFEAIVVHQQTHLQNENILNDYPINLKDSDEILSSRTEKLPQMRFLFNDKEVFQLA
CEIILIGIRSASNGSIEKDKMRGSLRAIVEDFMNVSNFDEILQICQNINYLDETKADIIC
QKDYYELKVTDEFEYQRKPVNESKQEDEPMDEEKKNSDAKLKEQAKEEKKEGLQTSPDNG
AKKALSLSQQLKPITVQSFKIDEKDIINESVFYPYFKPDYKLMYGSQNFYVILRQIYTIY
ERILKAKQIIDAKVEEDILNHFEEYQQHLLPRLNEIRQERFDVFLGGVILAMQTGSDFNK
YEDFARALLGSKAYLLFSFDKLIVQTVKQLLSIANDDSSQKSFKLSQRFQSNIESIKSEE
PSEQWKNESIYLSNFASTMQEINNFNGYGVRLLYSPKSQILSIHYFTINPYQFADKKHIN
ENLSYTENAVNYPIDANDVPYCSTIFMRRMKNLGLRHRPDLLISQDSIHTENNLVHRIQP
QTFKLYYGNESEDVMIYKRKSKLNVEEEFLTDFMIQAKTNDIKRRCFEKISQNSIIPGNR
DYSAIRDANMMSTLSNNRQVQPNSDQRQIQYNSAVFENEEDQPMANDANNKD