Identifiers and Description

Gene Model Identifier

Contig9814.0.g17

Standard Name

SIG70a

Aliases

Contig9814_0_g17

Description

Sigma-70, non-essential region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam04546 ) Sigma-70, non-essential region
  • ( pfam05009 ) Epstein-Barr virus nuclear antigen 3 (EBNA-3)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9814.0.g17(coding)
ATGGAACAAAACCCTATTATGAAAGTTGATCAGTAACCACTCTCAATAGATGACAAAGTT
AACTCTCGAACTCTTCAATAGATTGTATAAGAGAATTCAGCCACTGATATTACAAGCAAT
AGCAACAATCAGCCTGATTTGCTTGCAGATCTCCATGACACTATCGCATTCGCCACTAGC
AATCTAAACTCACTAAATCAGATTAAAGCTGATCTGACAGTCACATCTAACACTTTCAAC
TCAAATGTAGACAGTTCACACTAGAAGCAAGAGTAACTAGATGATGAAATACGTGGTGCG
TTCAGTGATATTGTGAAGGATTTCAGGGCTTTTGATATGATGAACGAGGATTTTGAGTAA
GGGCTGGGTAGCTTTATGGATGAGGAAATTCTTCAAAAGTTGAAAGCATTGGAGCTTAAT
TCTAGCAAGCAAGAAGATGGCTTAGGTGAGTTGCAAGATATCGATCTTGAGAATGCGTAC
CCAAATGAGAATATCGATGGTAGTGAGTTGTTGGATATTGAAGACGAAGAAGAAAAGGAT
AGTGATGAAGAGGAAGATGATAGTGAAGATGATGATGAGGATGGTGAAGATGACGAGGAC
GAGGAGGATACTTATAACTCACAAGGGAATTAGATGAATTCTCAGCGATTTCAGTTTCTA
TCTAAGCAACTCAAAACAATCTAGCAAAATTTAAACGATCCAAGCAAGAATTATAGTCAG
ATCGAAGAACTCAGACTGAAAATGTAAGAAAGTCACATTTAAAAAGAGTTGAGAAAGCTA
CAATAGGAAAGTAGATCTCAACAGTAATTTGTATCATAGTAGCAGCATCAGAATTCTGAT
CTTAGATAACAGAATTAAAACTAGTTTCACAGCTGTAACCAATAAAATCCTTTTGTGAGT
GGAAACTTGTACTATGGAGGGAATGGCTTTGGCTCTAACTAACACCAAAATCCCTTTAAC
TCAACTATGAGTCAAAATAACTAATTTAGACAGAACTGA


>Contig9814.0.g17(protein)
MEQNPIMKVDQQPLSIDDKVNSRTLQQIVQENSATDITSNSNNQPDLLADLHDTIAFATS
NLNSLNQIKADLTVTSNTFNSNVDSSHQKQEQLDDEIRGAFSDIVKDFRAFDMMNEDFEQ
GLGSFMDEEILQKLKALELNSSKQEDGLGELQDIDLENAYPNENIDGSELLDIEDEEEKD
SDEEEDDSEDDDEDGEDDEDEEDTYNSQGNQMNSQRFQFLSKQLKTIQQNLNDPSKNYSQ
IEELRLKMQESHIQKELRKLQQESRSQQQFVSQQQHQNSDLRQQNQNQFHSCNQQNPFVS
GNLYYGGNGFGSNQHQNPFNSTMSQNNQFRQN