Identifiers and Description

Gene Model Identifier

Contig17511.0.g63

Standard Name

SGS1b

Aliases

Contig17511_0_g63

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010300004.001709789838121e-126ATP-dependent DNA helicase, Re
cQ family protein
SGDYMR190C1.9991070409258158e-114SGS1 SGDID:S000004802, Chr XII
I from 645258-640915, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17511.0.g63(coding)
ATGAAGAGTAACTTAGATTCGATTCTTAATACTGACCTTAGTCTGGCTCGCTTTAGAGCT
CAACCAAACTTAATTAGTACATCAAATTCTGAAAACATTTATGATGTTAGGAAGCAAAAC
TCTCTTGCGATAAATGGGAATACTGCTATAAGAAATCAAGCTCCTAATTAGCCTATAAGA
AGTCACTTGTAGCCTTACTATAACGATGAGCAAGCTTAATAGTTTCAAGGAGGTGTTTAA
AGGAAACCAAGTATCAGTCCTGTAGGAGGTATATCATTGAAAATAGGAAATTAAGTATAA
TAAAATGCTTCTTACCAAGTTGAATTTACTAAGAAGAAACTGGGGGTAAGCGGAAAAATA
ACTTCTGATGGGTTGAAAAGACTTGGTGGACCTATGGGAATGAATAAAGACAATCAAAGT
TGTACGAAGTAAATCTCAGAGACTAATAGTTTTGGTATTAACTTTGAAAAGACTTTCACA
CCTAATCGCAAGTTCAACCACAATATTCGATCAGATTTTAACAATCATTATGATGGGAAC
TAAATGAATAGGTATCAGCTCTAACAATAAACAAGAAGAGTGAATGAATCATTCCAGAGA
CCCTTTAAGCCTTTGCCAAAACCTCAGTTTGATGAATATGCTGGAATGGATGAAGTCCAA
GCATTCAAATCTTCTCTAATGTGTGCTCCTACTTCAATGAATAGGCAATATTAAAATGTG
CCTTCTAACTAGCCCTTCAGACCTATGATTGATTCTCAGTATAAGCGATTGAAAGATGGG
GAGGCTAGAGAATAGCAAATTATTTCAGTTAATCCCACTATTTAAACTGACGCTTATGAT
TCAATTATTAAAGAAAATGAAAACAAGCAGTATGATGATAACGGAGAACTTGTAAATTTA
GGAAATCCTGATGATGAACATTTCTTGTATGAGGGAGAAGATAAGTATAAGGCCTATAAC
TTAGAGAATTAAGGCAAAAATGAGTGGAGGGATACTAAATTTCCATGGGATCAACATATT
CAAGAGTTTAATTAGAAAGTATTTAGAAATAAAACTTTTCTAGAAAATCAAAGAGAGATC
ATAAATGCTGCTTTGAATGGAAAAGATGTAATGGCTTTAATCCCCACTGGTGGAGGTAAA
TCTTTGACTTTTCAACTAACTGCTCTAATGAATAATGGTTACACATTCGTAATTATGCCC
TTAATTGCTCTAATTGAAGATTAAATCGAACAACTTAGAAGATTGAAAGTGAAATGTGTT
TACTATAACAGGTCTATAAAATAAGGGCAATTTTATACCGATCTTTTGGCAAATAGTGAT
CCTTTAATGAAATTGATTTACTTAACTCCTGAGAAACTGGTTTAAACCAAACCATTTATA
AATATACTAGATAAACTCTATCAAGACAATCGCATTGCAAGATTTGTTATTGATGAGGTT
CATTGTGTGAGTCATTGGGGACAAGATTTCAGAAAAGACTATAGAGAATTGCAAATTTTA
AGAATGAGATACCCAACTGTCCCTATGATCGTTTTAACTGCTACTGCCACAATAGCAGTT
AAATATGATATCGTTAAGCATTTAAAACTTGATAATATAGTATTCTTTCAATCTAGTTTT
AACAGACCTAACTTACTTTACGAAATAAGAGACAAAGCCAAAATAAAGAAAAATATTGCA
GAAGACATCATTATGCTTTTGAGAGATCGAAAGTATGTCTATTAAAGTGGCATTATATAT
TGTCTTTCAAGAACAGAATGCGAAGAACTTTGCAGAGAGTTAAGTGAGTTTGATGTAAAA
TGTGACTATTATCATGCAAAAATGAATGAGAATGAGCGTAGAATTATACAGCAGAGGTGG
ATGAGAAATGAGATTCATATAATTATAGCCACAATTGCATTTGGTCTTGGTATAAACAAA
AGAGATGTGAGGTTTGTCATACATACTACTATACCAAAGAGTTTAGAGAATTATGCTTAG
GAATGCGGTCGTGCGGGTAGAGATGGTGAAAATGCAAATTGTATCCTTTACTACTCATAT
GCCGATAGAAAACGTTTGGAGTTCTTCATCATTTCCAATACCGAAAATACAGCTGGTAGA
AAGAATGAAAACCTACATGCTCTGTATAAAATCCTTGAATTTTGCGAAGAGCCTTATCTT
TGTAGAAGAAAGATTCTCTTAAACTATCTGGGTGAAGATTTTAAGTCTAAGAAGTGCAAT
AATATGTGCGATAACTGTAGGAAAGGACTTAGAGTGGCTGAAATAGATTTCACTGAATAA
GCTAGATATGTGGTTGCTATGGTTGAAAGTGCACTTAAAAAGAAGATGGACTTGACTCTC
ATATAGATATGCAAATTCCTTAGAGGCAAATAATGTGTGATGTCTAATCCAAACAAGACC
ACTAAAATGGATGAAATCAAGTAATCCTACTACGGCAGACTCTCTGATTACTCTGAGGAG
CTTATAAAGCGTATTGTAATGAGGCTTTTGATAAATAAAGTGCTGAAGGAAAAATTCAAT
GCATACCAGGTAGAAGCCACGATATTGGTGTATCTCATACCAGGACGAATGTTTGATGCC
TTCAAGAGAGGGCAAATGCGAATTGTACTTACTGATTGTTTGGAGAAAGAGTCAGAGAAT
CAATACATTAAAGCAAAGAAGAAGGAAGATAAAGATCTCAAGAAGAAGTTTCATGGAGAG
GGTGAGGACCCAAATGAACAAGCTAATTAAGATGACTAAGCTAAAAAGAAGAAGTCTGGT
AAAAGAGGTTGA


>Contig17511.0.g63(protein)
MKSNLDSILNTDLSLARFRAQPNLISTSNSENIYDVRKQNSLAINGNTAIRNQAPNQPIR
SHLQPYYNDEQAQQFQGGVQRKPSISPVGGISLKIGNQVQQNASYQVEFTKKKLGVSGKI
TSDGLKRLGGPMGMNKDNQSCTKQISETNSFGINFEKTFTPNRKFNHNIRSDFNNHYDGN
QMNRYQLQQQTRRVNESFQRPFKPLPKPQFDEYAGMDEVQAFKSSLMCAPTSMNRQYQNV
PSNQPFRPMIDSQYKRLKDGEAREQQIISVNPTIQTDAYDSIIKENENKQYDDNGELVNL
GNPDDEHFLYEGEDKYKAYNLENQGKNEWRDTKFPWDQHIQEFNQKVFRNKTFLENQREI
INAALNGKDVMALIPTGGGKSLTFQLTALMNNGYTFVIMPLIALIEDQIEQLRRLKVKCV
YYNRSIKQGQFYTDLLANSDPLMKLIYLTPEKLVQTKPFINILDKLYQDNRIARFVIDEV
HCVSHWGQDFRKDYRELQILRMRYPTVPMIVLTATATIAVKYDIVKHLKLDNIVFFQSSF
NRPNLLYEIRDKAKIKKNIAEDIIMLLRDRKYVYQSGIIYCLSRTECEELCRELSEFDVK
CDYYHAKMNENERRIIQQRWMRNEIHIIIATIAFGLGINKRDVRFVIHTTIPKSLENYAQ
ECGRAGRDGENANCILYYSYADRKRLEFFIISNTENTAGRKNENLHALYKILEFCEEPYL
CRRKILLNYLGEDFKSKKCNNMCDNCRKGLRVAEIDFTEQARYVVAMVESALKKKMDLTL
IQICKFLRGKQCVMSNPNKTTKMDEIKQSYYGRLSDYSEELIKRIVMRLLINKVLKEKFN
AYQVEATILVYLIPGRMFDAFKRGQMRIVLTDCLEKESENQYIKAKKKEDKDLKKKFHGE
GEDPNEQANQDDQAKKKKSGKRG