Identifiers and Description

Gene Model Identifier

Contig7284.0.g45

Standard Name

SF3B4b

Aliases

Contig7284_0_g45

Description

Zinc-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7284.0.g45(coding)
ATGCTGTACGAAGTAACTCAGGACATTTTGGACTTGATCAAGCCTTTCTCCAGCATGAAT
GCCAACGTTGCTTTGAGACACTATGATAAAGCTTGGTCTAACAAAGATCAGAGAATCAGA
ACCTAGCTATTCTACCATTCAGAGTCAAAATTCAATACCTAAGGATTTGTGACATTCAGA
GTTCCCAAGAAATGCAAATGCTCGTGGCCCTCAGCTTTTGGAACTTTTGAGATACTTTAC
GTGGCATATCATTCTCGCAATGAGTAGAGGTTCTATGTTTATGTGACTGCCCTTATCTAC
AAGCAGAAATGCAGAAAACATGGTAGATATGCAGATCCTATCATGTCAGATGATGATCTT
TCGATTCTCTGCAAAAGCTTTTGGACTTTTCTGGCTGAAGAATTGTAGATCACAAACCAC
TATGGACTTCAGGAACTCAAAGAGAAGGAGGAAGAGGTGAAGGTTCAATTGAAGCAATCT
AATGAAAAGGAAGCTGAGTACTAGAAAAGATACGAAGGTGTAGACAGACTAAGTGAGAAG
TTCCTTGAGATGGTGATTAAAGACTATGATGAAAATCTAAAAGAGAAGCTGATCTCGCAA
GAAAAGGAAGATTTTAACCAGAAATCTTCAGGTAGAAGTTCTCTCACTAGTTCAGCCCAG
AAGACTAAGGGAAAGCACGTATCTTCACTCTGCCAAGCATGTTAAATGGGAGCATGTACT
TACACTAAAAAATTGCTCTCTCCTTGA


>Contig7284.0.g45(protein)
MLYEVTQDILDLIKPFSSMNANVALRHYDKAWSNKDQRIRTQLFYHSESKFNTQGFVTFR
VPKKCKCSWPSAFGTFEILYVAYHSRNEQRFYVYVTALIYKQKCRKHGRYADPIMSDDDL
SILCKSFWTFLAEELQITNHYGLQELKEKEEEVKVQLKQSNEKEAEYQKRYEGVDRLSEK
FLEMVIKDYDENLKEKLISQEKEDFNQKSSGRSSLTSSAQKTKGKHVSSLCQACQMGACT
YTKKLLSP