Identifiers and Description

Gene Model Identifier

Contig15452.0.g39

Standard Name

SF3B4a

Aliases

Contig15452_0_g39

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam08206 ) Ribonuclease B OB domain
  • ( pfam09707 ) CRISPR-associated protein (Cas Cas2CT1978)
  • ( pfam11608 ) Limkain b1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000239909.998285701479858e-93Splicing factor 3B subunit 4
SGDYOR319W1.000137892321693e-31HSH49 SGDID:S000005846, Chr XV
from 912822-913463, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15452.0.g39(coding)
ATGAACGATAAATTATCACATCTAGCAGGTGGTCCGCTATTTGAAAGAAATCAAGAAGCC
ACTTTATATGTTGGAAACTTAGATACTAAAGTGAATGAAGAACTTGTTTGGGAACTTTTC
TTACAATGTGGTGCTATAGTAAACGTCCACATTCCTAGAGATAAAGTGACAAATGAGCAC
TCTGGATATGGCTTCGTGGAATTCAAGACTGAGGAAGATGCTGATTACGCAATTAAAATC
ATGCACATGGTTAAGCTATTTGGAAAGCCAATAAAAGTCAACAAAGCCAGTTAGGATAAG
AGAACTCAAGAGGTAGGAGCTAATGTTTTTGTTGGAAATTTACATGAGGATGTCGATGAA
AAAATGCTCAGAGATGTATTTTCATCTTTTGGAATAGTCTTGAGTACTAAAATTATGAGA
GACCCAGAAACTTAAGTGTCTAAGAGATATGGATTCGTTAGTTATGACAACTTTGAGAGC
TCGGATGCATCAATCTAAGCTATGAATGGATAGTACTTGTGTGGAAAGCCAATCGATGTG
AGTTACGCTTACAAGAAAGATGCTATTGGAGAAAAGCATGGTACTTTAGCTGAGAGAGTT
TTGGCTTTTAATAAACCAAATTTACCTGGTTAAAAAGTAGCAGACACTTCCAAACTTCCT
CCTACTACAAATTAATTTGGAGGAGGAATGAATGGAATGCCATAAGCTAACCTTTAACAA
TAAATGACGCCAATGAACGCAACTAACATGGCTGGTTCAATGATTAATCCAGTTGGCGGG
TACAATGGATAATCAGCCTATTAATCCATGGGATTTTAAGGAATGCCTTAGTAAATGCCA
CCTCCTCCAAACTTTCCTCCAATTCAATAGTAGCAATAAATGTACCAACAGCATCCTCCT
AGAATGCCTCCTCCTGTTAGATGA


>Contig15452.0.g39(protein)
MNDKLSHLAGGPLFERNQEATLYVGNLDTKVNEELVWELFLQCGAIVNVHIPRDKVTNEH
SGYGFVEFKTEEDADYAIKIMHMVKLFGKPIKVNKASQDKRTQEVGANVFVGNLHEDVDE
KMLRDVFSSFGIVLSTKIMRDPETQVSKRYGFVSYDNFESSDASIQAMNGQYLCGKPIDV
SYAYKKDAIGEKHGTLAERVLAFNKPNLPGQKVADTSKLPPTTNQFGGGMNGMPQANLQQ
QMTPMNATNMAGSMINPVGGYNGQSAYQSMGFQGMPQQMPPPPNFPPIQQQQQMYQQHPP
RMPPPVR