Identifiers and Description

Gene Model Identifier

Contig1943.0.g12

Standard Name

SF3B3

Aliases

Contig1943_0_g12

Description

CPSF A subunit region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam03178 ) CPSF A subunit region
  • ( pfam10433 ) Mono-functional DNA-alkylating methyl methanesulfonate N-term

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005303509.997093137033517e-262CPSF A subunit region family p
rotein
SGDYML049C3.0011931572567413e-53RSE1 SGDID:S000004513, Chr XII
I from 178305-174220, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1943.0.g12(coding)
ATGTACCTATATTCACTGACTTTAAACTAGGCGACTGCCATAAATAACTCAGTATATGGA
AACTTTTCAGGCCCTAAACAGCATGAAATCGTAGTCTCTAAAGGTAAAATCATGGAGATG
CTGAGATTAGATGAAGCAACACAGAAACTTCAAGTTGTTTACCGCCAGGAAGTTTTTGGA
CTTATAAGGAAAATGATACCATTTAGACTACTAGGAATGCAAAAGGATTTCCTAGTAGTA
GGATCTGACTCTGGCAAGATTGTCATATTAGAGTATGACGGAGAACATAATAAATTTGTC
AAGATTCATCAAGAAACATTTGGTAAAACAGGATGCAGAAGAATAGTTCCAGGCGAGTAT
ATAGCTGCTGATCCAAAAGGTAGAGCAATAATGATTGGAGCTGTAGAGAAATAAAAATTC
GTTTTTATTCTAAACAGAGATTCATAAAATAAGTTGACAATTTCAAGTCCATTAGAAGCT
CACAAGCCTCATACTATTACTTTTGCAATGGTTGGAGTTGATGTTGGAATTGAAAATCCA
TAATTTGCTTGCTTAGAAGTAGACTACGGTGAAGCAGACAGTACTTATAGTGCTGTAGTT
ACTGGCTAACACTAGAAAATGCTAGTGTTTTATGAAATGGATCTTGGACTTAATCACGTT
GTAAGAAAGTACTCTACTCCAGTTGATAACAGTGCTCATATGCTGATAGCAGTGCCAGGA
GAACCATACGGACCATCAGGTATATTAGTGGTCTGTGAAAACATGATTTCTTACAAAAAG
GTAGACCATGATGATAGAGAATGTTCAATACCAATAAGAAACGAGCAAGCAGATAAAAAT
GGAACATTCTTTACTGCTCATTCAACATACACTTCAAAAGACATGTTCTTCTTTCTATTA
TCAAATGAATTCGGAGATATTTTCAAAATTAACTTAAACTTTACAAATGCTTAAGTACAT
GGAATGACTATCCAGTATTTTGATACTACTACTCCCACTGTATGTATGAATATTTTGAGG
CCTGGTTAATTATTCTGTGCTTCAGAATTTTCAAATCATACTCTTTACACTTTCTTGGAT
ATTGGTGAGAATGACCCAAATCCTATTATAACTTCTTCAGCTGATAGAAAACCCCATGGC
TAACAAACCTTAACAACTTATAATCCCAGAGAATTTTTGAATCTCTAAGCCGTAGATGAA
TTCCCAAATTTAGCTTCAATTAATGATATGAAAGTAGAAGATTTGACTGGAGAGGGTAAT
CCTTAAATTTATCTTGCAAGTGGTAGAGGAGCATAGGGATGCTTAAGAGTTCTGAGACAT
GGACTTACAATTATTGAGAAAGCTGTTACAGCTATGCCTTAAAAACCATTAAATGTTATA
ACTGTAAAGGGCAAGACAACTGATGTCTTTGATAAGTATATGATCGTCTCATTCCAGCAA
CAAACTTTAGTATTAAGCATTGGATAAGAAAAAGTGTCCGAAGTTAAAGATTCTGGATTT
GTTGATAATGAACGCACCCTACATGTGGGTATCCTTGAAGATAACTCCTATATCTAAGTA
ACTCCAAAGAGTATTATTCATGTTAAAGGAGATCAGCAAAATAGAAAGAGAGCTAAGTGG
GATAGTGGCTAAGGAAAAATTGTAAAGGCATGTTCTAACCAAAGATAGGTTGCAGTTTCA
ATTGAGGGTGGTCAAATTGTTTACTTTGAGTTAGATGAAATGAGCGGGACTCTTAATGAA
GTCGAAAGTAGATTCTATGATTCAGAAGTTGCCTGTATTGATATAGCTGATGTACCCGAG
GGTAGACAAAGATGTAGATTCTTAGCTGTAGGGTATGCTGATAAAACTGTTAAAATTATG
TCTTTAGACCCAGAATCATGCTTGTAAAGAATTTCTATGCAAGCTTTGCCAGCACATCCA
GAATCAGTTGCCCTGATTTCATTCCAAAGGGATGAAGTGGCTTAATAGTAACAACAACTT
TTCCTCCATGTTGGTTTAGTAAATGGTGTACTGCTTAGAACTTTAGTAGATAATGTTACT
GGAGTACTTTCAGATTCAAGAACGAGATTCTTAGGAACCAATTCAATTTCATTAGCCAAA
GTAAGATAAGGAAATACCAATGCTTTGGTAGCACTTTGTAATAAACCATGGTTATGTTAC
ACTCACATGTCAACAAATAAAGTTAATATCACACCACTTAGCTATGAAATGCTTGAAGTA
GCTTCATCATTCTGCAGTGAGAAATGCCCAGATGGAGGTATTGTAGCCATTAGTGGAAAC
ACTTTGAGAATTATTACAGTTGAGAGACTCGGAGAAAACTTCACTCATAAAGTTATGCCT
CTCAGATATACTCCAACTAAGATTCAGATTCATAGAGAAACTAATTATCTTGTCATATTA
GAGAAAGATCATAATTCATATTCTTATAGTGAGAGATTACGCATGAAAGAAGAAATCGCT
AAGAATACTGAAGATGAAAATTACTTAGCATTAGATGAATCAAGAATTTCTTATCCAAGA
GCAGGTCAAAATAAATTTGCATCTTGCATAAGAATAGTAGATCCCTACCTTTTACAAACT
TTGGAGTTGATAGAATTCGAAAATAATGAAGTAGTTTTCTCCCACTTTATAGCAACAACT
TTAGGGAATCCTGGTGAAACCCATTTGATTTTAGGAACTGCACTTAATGTCACTTTCCAG
CCAAGATCTTGTTCTGTGGGCTTCATAAAAACCTATAAATTTGTGAACAACGGTCAATCC
CTATAACTTATGCATTCCACTCCTTGTGAAGATATTCCAATGGCATTTAATGAATACAAA
GGAAGATTAATTGCTGGTGTAGGCCCTATCTTAAGAATCTATGAATTAGGGCAAAAGAAA
CTACTGAGAAAAGTTGAGAACAAGAACTTCTAAGCTCCAATTATTCAAATTTAAGTTGAC
GAAGGTAGAATTTATGCTGGAGATCTATAAGAGAGTGTGCATGTACTTAAATATAAACCA
GAGGATGTGCAACTCTATATATTTTCGGATGATATCTTGAACAGATGGCTTACTTCCTTC
TGTTTGCTTGATCATGATACAATCGCTGGAGTTGACAAGTTCGAAAATGTGTTCATTAAC
AGGCTTCCAGTTGGCTGTGAAGACGATGCTGAGGATGATCCTACTGCTACCAAGTTTAAA
TGGGAGAACGGATACTTGAATGGTGCTGCCTTTAAGATGGATCCCATCTGTCAATTTTTC
ACTGGAGAGGTAGGCACTTGCATACAAAAGTGCTCTTTAAATACCTTATCAGGAACAAAC
TCTGAGATAATTTTGTTTGGAACTACCTCTGGATCTTTGGGCGCTCTCTTGCCTTTCGAG
ACTCGTGAAGAAATAGACTTTTTTGTGCACCTAGAAATGTATCTGAGAATTGAGGCCCAA
CCTCTTTGTGGTCGTGATCATGTTACTTTCAGGTCATCATATGTCCCTGTGAAGGATGTG
GTTGATGGGGATCTATGCGAACAATTTGCAAGCTTGGAATTCAACAAGTAAAGAGTACTT
GCCGAAGAGATGGACAGAACACCCCCTGAAGTCATGAAGAAACTTGAAAATATGAGGAAC
AAGATACTCTGA


>Contig1943.0.g12(protein)
MYLYSLTLNQATAINNSVYGNFSGPKQHEIVVSKGKIMEMLRLDEATQKLQVVYRQEVFG
LIRKMIPFRLLGMQKDFLVVGSDSGKIVILEYDGEHNKFVKIHQETFGKTGCRRIVPGEY
IAADPKGRAIMIGAVEKQKFVFILNRDSQNKLTISSPLEAHKPHTITFAMVGVDVGIENP
QFACLEVDYGEADSTYSAVVTGQHQKMLVFYEMDLGLNHVVRKYSTPVDNSAHMLIAVPG
EPYGPSGILVVCENMISYKKVDHDDRECSIPIRNEQADKNGTFFTAHSTYTSKDMFFFLL
SNEFGDIFKINLNFTNAQVHGMTIQYFDTTTPTVCMNILRPGQLFCASEFSNHTLYTFLD
IGENDPNPIITSSADRKPHGQQTLTTYNPREFLNLQAVDEFPNLASINDMKVEDLTGEGN
PQIYLASGRGAQGCLRVLRHGLTIIEKAVTAMPQKPLNVITVKGKTTDVFDKYMIVSFQQ
QTLVLSIGQEKVSEVKDSGFVDNERTLHVGILEDNSYIQVTPKSIIHVKGDQQNRKRAKW
DSGQGKIVKACSNQRQVAVSIEGGQIVYFELDEMSGTLNEVESRFYDSEVACIDIADVPE
GRQRCRFLAVGYADKTVKIMSLDPESCLQRISMQALPAHPESVALISFQRDEVAQQQQQL
FLHVGLVNGVLLRTLVDNVTGVLSDSRTRFLGTNSISLAKVRQGNTNALVALCNKPWLCY
THMSTNKVNITPLSYEMLEVASSFCSEKCPDGGIVAISGNTLRIITVERLGENFTHKVMP
LRYTPTKIQIHRETNYLVILEKDHNSYSYSERLRMKEEIAKNTEDENYLALDESRISYPR
AGQNKFASCIRIVDPYLLQTLELIEFENNEVVFSHFIATTLGNPGETHLILGTALNVTFQ
PRSCSVGFIKTYKFVNNGQSLQLMHSTPCEDIPMAFNEYKGRLIAGVGPILRIYELGQKK
LLRKVENKNFQAPIIQIQVDEGRIYAGDLQESVHVLKYKPEDVQLYIFSDDILNRWLTSF
CLLDHDTIAGVDKFENVFINRLPVGCEDDAEDDPTATKFKWENGYLNGAAFKMDPICQFF
TGEVGTCIQKCSLNTLSGTNSEIILFGTTSGSLGALLPFETREEIDFFVHLEMYLRIEAQ
PLCGRDHVTFRSSYVPVKDVVDGDLCEQFASLEFNKQRVLAEEMDRTPPEVMKKLENMRN
KIL