Identifiers and Description

Gene Model Identifier

Contig22799.0.g83

Standard Name

SF3B2

Aliases

Contig22799_0_g83

Description

Domain of unknown function (DUF382)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000137903.001032840497736e-70PSP family protein
SGDYMR240C1.9994920269952867e-34CUS1 SGDID:S000004853, Chr XII
I from 751240-749930, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22799.0.g83(coding)
ATGAGTGCGAATGGAATGTTGAGTATGGGAGATGACATCCACTATCACACATCTTCTAAT
GGATAGACATCTGACTCAGTTTCAAATTAATAACCCAAAGAAGTTGATAAACTTAAGTAG
AATAAAGCCAAGAGAAGATAAAAGAACAGAGAGTAAAAAAAGAAGAACAAGAAAGATAAG
TTGCAGATGGAGATTGATGAGAAGGTCAACTTTCTGAAATCTGCAATTAAGTCTTAAGTC
AACAGTATGGTGACTGATTAATTTGATGCTGACGGAGATCAGAGCATGACAACCTCTAAT
GGGGATGGTGAACCTCATAATCACAGTAATTAATAAATCAACCAAAATTAACTAAATAAT
GGTAAGATTGATCTCAGCAACATTGAATTCGAGTATGTCAACATGGATGAGAATATCCTT
GCTCCAGGTAGACACATTGCTGAATTTAAGCATATTTTTGAGCATTTCACTACTCCAGTA
AATCAAAACCTGGGCAAGAAGAAAGAAGATGAGAAGAAGGTATCTGAGGAAAAAGATGCC
TTCACCAAACACACAGAAATGCATGAGGACGAAGAGAAGAAAGAAAAGTAGATGTCAAAG
AAGATGAGGAAACTTATGACTAGAATGAAAGTATTTGATCTTAAAATGAAGATTAGACGC
CCTGACTTGGTTGAAAACTGGGATGTTACAGCCAAAGATCCTCTTTTCTTAATGTAAATG
AAAATGACAAGGAATTCTCGAAGATACCTTTAATATAAGAGAGGTATTCACAAACCTCCC
TTCAAGTTGCCTGATTTCATTGAAGCTACAGGAATAGGAAAAGTGAGAGAATAAACCAGT
GACAAACACAAGACTCTAAAGCAAAAAATGAGAGAGAGAATGCAGCCAAAGATGGGCAAA
ATTGATATTGACTATTAAGTGCTTCATGATGCCTTCTTTAAAAACCAGAAGAAACCTAAA
CTTACACCTCATGGAGATCTTTTCTACGAAGGAAAAGAGTATGAAATCAGAATGAGAGGA
TACAAGCCCGGCAGATTAACTCCAGAACTCAGACATGCACTAGGAATACCTGAAAACTCT
CCTCCTCCCTGGTTAATCAACATGCAGAGATATGGTCCTCCTCCAGCTTACCCAAATCTG
AGAATACCAGGTGTTAATGCACCTATTCCTGAAGTTATTACCTATGGTTTTGGTAGATTA
TTTACTGATGAGAAAGGAAGCACAGTATATGCTGATTGTCATGGACTTAACAAGGCTGTG
TATCAAAAGAGACAGAACAGAAAGCCTTATTGGGGATAAATTAAAGAATAAGTTGAAGAG
GAAGAAGAAGACGAGAGCATGGAAGAAGATGAGGAAGAGGAAGATGAGCCTGAGTATGAG
GGAATTGGAAGATCCACTTTGGGGATGCTAGATGATGATATGTATGAAGATCAGCTGTAG
CAAGTTCCACAGTATGAAGAGAGAACTAACTTCGATGAACTCAAAGCTGGTATTTCTTCA
CTCATTCAGAACACACTTCCAGTAACATCTTCAGTTGATATTAAGAAGAAGATGCCTCCT
CCACCACCCAATGAAGCCAGGCCACTTTATGAAATAGTCGAGGAGGTTAAGAACAAAGTG
GGTGACGCAAGTGATATATTCTAGTCAGGACATGGTTACAAGCTACCTTCTGGATAAGGT
CAGGCATCAGTAGAGCCAGATATCAATATATCTAAGGTTCAAGCTGCAGATAGTGCTAAA
ACAGTTGCAGAGAAGGAAGAAGAGAGGAAGAAGAAGGAGAAAGAGAAGAAAGATAAGTAC
AAGGTCAAGTTCTGA


>Contig22799.0.g83(protein)
MSANGMLSMGDDIHYHTSSNGQTSDSVSNQQPKEVDKLKQNKAKRRQKNREQKKKNKKDK
LQMEIDEKVNFLKSAIKSQVNSMVTDQFDADGDQSMTTSNGDGEPHNHSNQQINQNQLNN
GKIDLSNIEFEYVNMDENILAPGRHIAEFKHIFEHFTTPVNQNLGKKKEDEKKVSEEKDA
FTKHTEMHEDEEKKEKQMSKKMRKLMTRMKVFDLKMKIRRPDLVENWDVTAKDPLFLMQM
KMTRNSRRYLQYKRGIHKPPFKLPDFIEATGIGKVREQTSDKHKTLKQKMRERMQPKMGK
IDIDYQVLHDAFFKNQKKPKLTPHGDLFYEGKEYEIRMRGYKPGRLTPELRHALGIPENS
PPPWLINMQRYGPPPAYPNLRIPGVNAPIPEVITYGFGRLFTDEKGSTVYADCHGLNKAV
YQKRQNRKPYWGQIKEQVEEEEEDESMEEDEEEEDEPEYEGIGRSTLGMLDDDMYEDQLQ
QVPQYEERTNFDELKAGISSLIQNTLPVTSSVDIKKKMPPPPPNEARPLYEIVEEVKNKV
GDASDIFQSGHGYKLPSGQGQASVEPDINISKVQAADSAKTVAEKEEERKKKEKEKKDKY
KVKF