Identifiers and Description

Gene Model Identifier

Contig16616.0.g9

Standard Name

SF3B1

Aliases

Contig16616_0_g9

Description

Splicing factor 3B subunit 1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005296609.997093137033517e-262splicing factor 3B subunit 1
SGDYMR288W9.997093137033517e-262HSH155 SGDID:S000004901, Chr X
III from 845571-848486, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16616.0.g9(coding)
ATGTCAAATTAGAACAACTAGGGTGACCAAAACGATCCCAACAAAAAAGGAATTGGCTTT
GGAGCTAAAGGCGGTTTCGATAAAGGAATTTATGGAGCTAACAACTAAGATTTTCTAGAT
TATATTCCTGATGAGACTGATAAGGATGCCGCTATGGATCCTTTCTAAGCTAGAAGAAAC
TAGAAGCTCTCAACAATAACAGGATAAAAAGAATTGATCGAGGAAATGAAACTTGGTGGA
CCATAGGAAGATCCTATGAAAGATTTCGGTCATAAGAAAATCCTTGAGAGAGAGGATCAG
TACCATTAAAGAAGAATGAACCGTATGCTTTCACCAGATAGAGCAGATCCCTTCACTAAA
AAGTAAGGAGCAGCTGATGGATCTTCAAAAACTGGAACTCTTCCTTAAAAGAGAACTTAT
TATGACATTATGCAAGAGCAACAGTTAGACAATGAAAAGGCTGATGTCTATAGAAAAATT
GCTTAGAAATAAGAAGAAGAGAAAAGAGGCACAAATTAGCAAGAACAACTTAAGAGACAA
AAACTCAAGGATGAGACTTCTACAAATGCTAGTGTTACTATTAAAAGCTATGCTCAGTAG
CAACCATCAGACTGGGATAAGCATGAAGTAGGTCCAGTCAACAAAAAAGCAGCTGCTGTA
GTTGAAACCCCTAGACTCTCAACTAAATGGGATACTCCTAGAAGAACTCCGGCAATGGAA
GGTTAAACTCCAAGACGTAATAGGTGGGACTTGACTCCTGCTTCTTAAGGGCAACCAGGA
ACTGGTATTACCAGTGATACAACTACACCCTCCAGATTTAGTCAGTCAAGAAATGGTTTT
AGTGAAACTCCAACTCCAGGAAGATGGTCTCAACCAACTCCTATGAGAATGATTTCTGAA
ACACCTACTCCAGGTACTAGCAGATTTGGAGCTACCCCTATGGGTGGACAAGGAGGTACA
AGATGGGATTAAAAGCCTGGTTAAACTCCTGTTGGTAGTTAAGGTGGTTTTATGCAAACC
CCTGTCCAAGGATACAATCCAATGATGACTCCTGTTGGCGGTTAAACTCCTGGACTGTCA
GTTCCTTACTGGCAAAGAGACTTGAATGATAGAAATAGACCTTTGACTGATGAAGAGTTA
GACCAGATTTTGCCTTCTCAAGGTTATGAAATTATTAAACCCCCTGAAAATTATGTACCT
ATTCGTACTCCTTCTAGGAAATTAGCTGAGACCCCAGTAAACTATCAATAAACACCTTAA
GGCTTCATGATTCCAGAAGCTTCTGGAAAGCCTTATGATGTCCAGCAAACACCAGGAGGG
AAAGGTGAAAAAGACGCTATTCCTTTTATAAAACCTGAAGACGTAAATTACTTCAGCTCT
CTCTTGAGTGAAGTCGATGAAGAGCAACTTTCAAATGAAGAACAAAGAGACAGAAGAATT
ATGATGTTACTTTTGAAGGTAAAGAATGGTACACCTCCCATGAGAAAATCTGCACTTAAA
ACTCTTACTGAAAAGGCTAGAGAGTTTGGAGCTGGCCCACTATTTAATTAGATTTTGCCT
CTACTTATGAGTCCTACTCTTGAAGATCAAGAGAGACATTTGCTTGTCAAGGTTATTGAT
AGAATTCTGTATAAATTAGATGACTTGGTTAGACCTTATGTTCACAAGATCCTTGTGGTT
ATTGAGCCATTATTGATTGATGAGGATTATTATGCCAGAGTTGAAGGTAGAGAAATTATA
TCTAACTTGGCAAAAGCTGCCGGTCTTGCTACAATGATTTCAACTATGAGACCAGATATT
GATCACAACGATGAATATGTAAGAAATACAACTGCTCGTGCCTTCGCTGTTATAGCATCT
GCCCTTGGTATCCCTGCTCTTCTACCATTCTTAAAAGCCGTATGTCAAAGCAAGAAATCT
TGGAGAGCAAGACATACAGGTATCAAAATTATTTAATAAGTCGCCATTCAAATGGGATGT
GCTGTCCTTCCTCACTTGAAAAGTTTAGTTGATATCATCGAGCATGGCTTGAAAGATGAA
GAACAAAAAGTTAGAACAATCACTGCTCTTGCCATTTCAGCACTCGCTGAGGCTTCCAAC
CCATATGGTATTGAAGCATTTGAATCTATCCTTATTCCACTTTGGGATGGAATCAGCATT
TACAGAGGAAAAGCGCTTGCTGCTTTCCTTAAGGCTATTGGTTTCATTATTCCACTTATG
GATGCAGATCATGCTGGAGAGTATACCAAATTCGTGACACCAGTATTGATCAGGGAATTC
CAGAATAACGACGATGAAATGAAGAAAATTGTCCTGAAGGTTGTTAAGCAATGCGTAAGT
AGTGAAGGTGTTTCTGTTCAATATGTCCGTAAAGAAATGATTCCAGAGTTCTTCAGAAGT
TTCTGGTTAAGAAGAAACGCTCTTGACAAGAAAAACTACAAATAACTCATAGAAACTACA
GTTGAGATAGCAGGCAAGGTAGGAGGTGCTGAAATCATTAAAAAGATCGTTGATGAGTTG
AAAGATGACAATGAGACAACTAGAAAGATTGTCATAGAGACACTTGAGAGAATAATTGCC
GCTTATGGAGTAGCAGATATTGATGCCAAACTTGAAGATAGACTTATGGATGGAATATTG
TTTGCCTTCTCTGAATAAGCATCTGAAGATACCTAAACTGTGCTAAACGCATTTGGCACT
ATAGTCAACTGCTTAGCTGTAAGAGTAAAGCCATACATTCCACAAATATGCGGCACTATT
CAATGGAGACTGAACAATAGATCAGCCAGAGTTAGACAATAAGCTGCTGATTTGATTCAG
AGAATTGCATTAGTCATGAAAACTTGCGCTGAGGAAGGGTATATGGGAAGACTAGGTGTC
ATCTTATATGAGTATCTTGGTGAGGAATACCCCGAGGTTCTTGGATCTATCCTTGGTGCA
CTCAAAGCTATTGTGAATGTTATTGGTATGTCAAAAATGACACCTCCGATTAAAGATCTT
CTTCCCAGATTGACTCCTATCTTAAAGAATAGACACGAAAAGGTGCAGGAAAATTGTATA
GATCTAGTTGGTAGAATCGCAGATAGAGGTGCAGAATATGTCTCCCCAAGAGAATGGATG
AGAATTTGCTTTGATTTGTTGGATTTGCTCAAAGCACATAAGAAAGGTATCAGAAGAGCA
ACTGTTAACACATTCGGATATATAGCTAAAGCTATCGGACCTCAAGATGTCTTGGCTACA
TTACTAAACAATTTAAGAGTTCAAGAAAGACAAAACAGAGTATGTACAACTGTAGCTATT
GCTATTGTTGCTGAGACCTGTGGACCATTTACAGTCCTTCCAGCTTTGATGAACGAGTAT
AGAGTCCCAGAAATGAATGTACAAAATGGTGTCTTGAAGAGTTTATCTTTCATGTTTGAG
TACATCGGTGAAATGGGCAAGGATTATATATACGCTATTACTCCTCTGCTTGAAGATGCT
TTAATTGATAGAGATTTAGTTCATAGATAGACTGCTGCAAGCGCTGTAAAGCATTTATCT
TTAGGTGTTGCTTATCTTGGTTGCGAAGATGCGCTCACTCATTTGGCTAACTATCTCTGG
CCAAATGTGTTTGAGGTCTCTCCTCATGTCATTAATGCTGTCTTGGACGGTATTGAAGGT
ATTAGAGTTGCTCTTGGAGCAGGAAAGATCCTGTTTTACACACTCTAAGGAATGTTCCAC
CCTGCTAGAAGAGTCAGAGAAATCTACTGGAAAGTTTACAACAATATTTACCTCGGCGCT
CAAGATGGATTGGTCTCTGCTTACTCTAACTTCAAGGATGAAGGTATTAACACCTACAGA
AGAAATGAACTTGAAATGATGATCTGA


>Contig16616.0.g9(protein)
MSNQNNQGDQNDPNKKGIGFGAKGGFDKGIYGANNQDFLDYIPDETDKDAAMDPFQARRN
QKLSTITGQKELIEEMKLGGPQEDPMKDFGHKKILEREDQYHQRRMNRMLSPDRADPFTK
KQGAADGSSKTGTLPQKRTYYDIMQEQQLDNEKADVYRKIAQKQEEEKRGTNQQEQLKRQ
KLKDETSTNASVTIKSYAQQQPSDWDKHEVGPVNKKAAAVVETPRLSTKWDTPRRTPAME
GQTPRRNRWDLTPASQGQPGTGITSDTTTPSRFSQSRNGFSETPTPGRWSQPTPMRMISE
TPTPGTSRFGATPMGGQGGTRWDQKPGQTPVGSQGGFMQTPVQGYNPMMTPVGGQTPGLS
VPYWQRDLNDRNRPLTDEELDQILPSQGYEIIKPPENYVPIRTPSRKLAETPVNYQQTPQ
GFMIPEASGKPYDVQQTPGGKGEKDAIPFIKPEDVNYFSSLLSEVDEEQLSNEEQRDRRI
MMLLLKVKNGTPPMRKSALKTLTEKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVID
RILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDI
DHNDEYVRNTTARAFAVIASALGIPALLPFLKAVCQSKKSWRARHTGIKIIQQVAIQMGC
AVLPHLKSLVDIIEHGLKDEEQKVRTITALAISALAEASNPYGIEAFESILIPLWDGISI
YRGKALAAFLKAIGFIIPLMDADHAGEYTKFVTPVLIREFQNNDDEMKKIVLKVVKQCVS
SEGVSVQYVRKEMIPEFFRSFWLRRNALDKKNYKQLIETTVEIAGKVGGAEIIKKIVDEL
KDDNETTRKIVIETLERIIAAYGVADIDAKLEDRLMDGILFAFSEQASEDTQTVLNAFGT
IVNCLAVRVKPYIPQICGTIQWRLNNRSARVRQQAADLIQRIALVMKTCAEEGYMGRLGV
ILYEYLGEEYPEVLGSILGALKAIVNVIGMSKMTPPIKDLLPRLTPILKNRHEKVQENCI
DLVGRIADRGAEYVSPREWMRICFDLLDLLKAHKKGIRRATVNTFGYIAKAIGPQDVLAT
LLNNLRVQERQNRVCTTVAIAIVAETCGPFTVLPALMNEYRVPEMNVQNGVLKSLSFMFE
YIGEMGKDYIYAITPLLEDALIDRDLVHRQTAASAVKHLSLGVAYLGCEDALTHLANYLW
PNVFEVSPHVINAVLDGIEGIRVALGAGKILFYTLQGMFHPARRVREIYWKVYNNIYLGA
QDGLVSAYSNFKDEGINTYRRNELEMMI