Identifiers and Description

Gene Model Identifier

Contig8621.0.g10

Standard Name

SF1

Aliases

Contig8621_0_g10

Description

KH domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004445702.000214949834694e-50Zinc knuckle family protein
SGDYLR116W1.0000633497921574e-36MSL5 SGDID:S000004106, Chr XII
from 380822-382252, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8621.0.g10(coding)
ATGAGTGCAAACACCGCTTCGATTATAATCGGAATGGAAAATTAATCTGAGCCAGTTTAA
CTACAAAAAATTGATCCTTTTTACAAGGAAGCCAATAGTATTTATCTTTTTTTCGATTTA
TTTTTAATTATAGCCAGAGTGAGCAGATGGGAAGCTGAAGAGCATAGTTCAAGAAAAAAT
GGTTGGGGGGCAGATTATGAGAAAACTTTTACTCCTTAAACTTTTGGCTTTATTCCCAGA
AATTACACAATCGAAGAATTTGAAATTTGGATTAGGAGACATAGGCTGGATGATTTATAG
AGAAGAATTGCAGTGGCAGATTTCGAATAGAATGATGCAGATATAAGATCTCCTAGTCCA
GAGCCAATATATGACCCAAAAACTGGTTTGAGAATGAATACAAGAGATTAAAGACTAAAA
GATAAGTACTATAAAGAGAGAAATCGAATTGTGTCTGAGCTTGTGGAAATGGATCCATCT
TATATCGCGCCTCCTGACTATAAACCTCCTAAAAAGTTCAAGAAAATTCCGATTCCTGAT
CCAGATAATCCCATGCTTAATTATATAGGCCAAATTATTGGACCAGGAGGTACAACTCAA
TAGAAACTAGAGAGAGAAAGCAAATGCAAAATTCAAATTAGAGGTCATGGTTCTCAGAAT
AAGAATAAAATATACAATAAAGAAGAGGCTGATGAAAATGAACCTCTTTATGTTCTTGTC
ACAGCAAACACAGATGATCACTTGGCTAAAGGTTGTGCAATGATCGAGGCCATCATTTTA
CAGACGGATGAAGACAAGAAGTACTAAATGGTTGCCTATGATCATTTAACTACTAAAACC
AAGAAAGGATGGTGTGAAAACTGTGGTGAATAAGGTCACAAGTTTTATGAGTGTCCTGAG
AGATTACTTGGAAATACAAGCAACATTTATTGCAATATTTGCGGAAGCACAAACCATCCT
TCAGCAGATTGCCCAGAAAACAAGAAGAAAAAGTAGCAAGCTGAGGAGATAACACCTGAA
GAAGAACTTCATATTTTCCTTTAAACCCTGAAGGAAGAAAAGGAATAGAAGGCTAAGTTT
AAGGCAATTACAGCCTCTGGAGAGGGTCCTCGCCTTGTGAGTTATGCTTAATTTCAGGCA
GAGTAAGAACAAAAAACTATTTAAAATCAACAAATCTTTGCTTCAGGCTAGCCGAATAAG
TAACTCGAAAACGGAGTATAAAATGGCATTAAATATGGATTTTAAGCTCCTCCCGCTGTT
TCTTAATATTACTCAAATGATGCAAGTCGTCATGTTCAAAGTTATTAAACTACTAATTAC
AATGAATCTTAGACTGCTACTAAGAGTTCATATGTCAATGATGATAAGCAGATTGCAATG
TAACAAGCTCCATAGTTATATCAGCAATAATCCCCTTCGATATAGATTGCTTCGTCAATA
ACTGAACCCATTAATTAAAACGGGTAGCATCCTGAAGATTCTCAAATGGAAGATCATCCT
GACTTAAAATCGAACTAGGGTTCTTCAAACCTTCTTGCTGAACAAAAGTCAGATTTGACA
AAGGATTTATTTTTACAGCAATAACAAGTTTTTTAGTCAACTTAGCAGACGTAGATCGGA
GCTCAAAGTACTTTCAAATCTTATAAATAAGAAGTTAGACCTCCAATGCCAGGTCCTGGT
CCTGCAACTCCCTATTAATATGGTTAACCCCCTTATCCTTATAGGCCACCCCCTGCTTAA
ATCCCTTATGGGTAATAAGTCCCCCCTGTTTAGGGAGCTTACCCTCCAGTACCTTAATAT
AATTATCCTCCTCCAGGCGTGAATTATTAAGGTTATTACGGTGGAGCCTATGGGTAACAA
TAAGCTTACTATAACCAATATTATGCTTCAGGCTATCAGTATCCTCCTAATTACTATTAT
CCTTAACACTATCCTTAATAGTAGGGCTATCATCCATAGTAGTATCCAGCTGGATAATTC
TAACCACCAAGCATACCTCCCCAAGCGAATGGCAGTGCCATATAATATTAAAATGGTACT
GATTCAAGCAAAAATATCGAAGACGGAACTCAACAAAATAAGCCATTAGAGTCATTAGAT
GAAAGTTCAAAGAATTAAATTCATACAGAGAGCATGGCTTAATGA


>Contig8621.0.g10(protein)
MSANTASIIIGMENQSEPVQLQKIDPFYKEANSIYLFFDLFLIIARVSRWEAEEHSSRKN
GWGADYEKTFTPQTFGFIPRNYTIEEFEIWIRRHRLDDLQRRIAVADFEQNDADIRSPSP
EPIYDPKTGLRMNTRDQRLKDKYYKERNRIVSELVEMDPSYIAPPDYKPPKKFKKIPIPD
PDNPMLNYIGQIIGPGGTTQQKLERESKCKIQIRGHGSQNKNKIYNKEEADENEPLYVLV
TANTDDHLAKGCAMIEAIILQTDEDKKYQMVAYDHLTTKTKKGWCENCGEQGHKFYECPE
RLLGNTSNIYCNICGSTNHPSADCPENKKKKQQAEEITPEEELHIFLQTLKEEKEQKAKF
KAITASGEGPRLVSYAQFQAEQEQKTIQNQQIFASGQPNKQLENGVQNGIKYGFQAPPAV
SQYYSNDASRHVQSYQTTNYNESQTATKSSYVNDDKQIAMQQAPQLYQQQSPSIQIASSI
TEPINQNGQHPEDSQMEDHPDLKSNQGSSNLLAEQKSDLTKDLFLQQQQVFQSTQQTQIG
AQSTFKSYKQEVRPPMPGPGPATPYQYGQPPYPYRPPPAQIPYGQQVPPVQGAYPPVPQY
NYPPPGVNYQGYYGGAYGQQQAYYNQYYASGYQYPPNYYYPQHYPQQQGYHPQQYPAGQF
QPPSIPPQANGSAIQYQNGTDSSKNIEDGTQQNKPLESLDESSKNQIHTESMAQ