Identifiers and Description

Gene Model Identifier

Contig18196.0.g15

Standard Name

SETDa

Aliases

Contig18196_0_g15

Description

TPR repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005639001.99904246446894e-143SET domain containing protein
SGDYOR027W0.000000000004997916451710233STI1 SGDID:S000005553, Chr XV
from 381053-382822, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18196.0.g15(coding)
ATGCCTAAAAACAACAAGAAAAAGCAGACAAAAGATACAAAGGATCCTCAAAAACTTAAG
GAGCTCGGTAACAAGGCATTTATAAATAAAAATTATGAAGAAGCCATTGAAATGTTCTCA
AAAGCCATCGAAGAGGACCCCACTGATCCTGTGTTTTTCACAAACAGAGCTGCAGTATAC
CTGACCATAGATAAACTTGATGAGAGTGTGAAAGATTGCGATAAGGCAATTGAAATCAAT
AAGAACTTTGTAAAGGCATACTTCAGAAAAGCATAAGCTTTGAGAGAGAAATTAGATGAT
TTAGGAGCCATCGAGGTCTTGAAAGCAGCGATTGAATTAGACCCAGAAAACAGTGACTTA
TCAAAGCTATTAGATCAGACCAGACAAGAATATGAAGAGGACAATAGTATTCCAATAGAT
CATCCAGAGAGACAGAGATTCGAGACGCTGTTGAAGTGGCTTGAGCAGGGAGGTTCTCAT
TTTGAGAAATTGAAAATTAGATATTACACTGCTGATTACAGAGGAGTGCATGCTGCTAGA
GACATCAAGAAGGGAGAGATTATCCTATATGTTCCCAAGCACTAGATCATCACACTTGAA
ATGGCCATGACCTCACCAGTTGGAAAGAAGATGTACGAGAAGGGATTAAGGCAGAGATTA
ATATCACCAAAGCATTCTTTTTTGAGTACTTATATTATGCAAGAGAAAAGAAAGCCTGAG
TCTTAATGGCAAATTTATATTGATATTCTCCCCAAAAACTTCTCTAACTTTCCTATTTTC
TTCACTGAAGAGGAGAGAATATGGCTTAAAGGAAGTCCTTTCTTGGATCAAATTCTTGAG
AAAATTGAAGACATTAAAGCTGACTACGATCTTATCTGCAAAGAAGTTCCTGAATATGTT
CAATTCCCCATAAGAGAGTATTCAGAAATCAGAATGATGGTGTCCAGCAGAATTTTCGGT
ATTCAAATCGAAGGAGTAAAGACAGATGGATTTGTTGCATACGCAGACATGTTAAATCAC
AAGAGACCTCGCCAGACTTCCTGGACTTACACTGATGAAAAGTAGGGTTTCATTATTGAG
GCTATGGAAGACATTTAGAGAGGAGAGCAAGTTTATGATAGTTATGGAAAGAAATGCAAT
AGTAGATTCTTCTTGAATTATGGGTTCATCAACCTAAACAATGACGCCAACGAAGTTCCC
ATCAAGGTATACTATCACACTGACGATTAGTTGAAGCAAGTGAAGTAAGACATGATTGTA
GATCACTCAGAATTCAAGAAATTCAGAGTGGTTGAGAACCTAGAAGACAGAGTGATGTAG
GAATTCTTTTCTTGGTTAAGATTCGTAGAGTATGATGAGAACATCACTCTCATTTATCAG
TATCAAGGAGCAGCTATTTCAAAAGCACAAAAGTATAAGAGAGGAGATGAGTCAGATTCA
GATGAAGCTGACGATCCAAGCAAGGGCTTCAAAGCCAAGGACTTACCACCTCTTTCCATA
AGAAACGAGAAATTAGTTCTAGAGAGAATAATTAATCTCGCTAAAGAGGCATACGATAAG
TATGAACGCACATATGAAGAGGATCTTAAGATTCTAGAGAGAGAGGATCTCACTTTCAAC
CATAGAAATTGCTTGCTTTATACATCTGGAGAGAAAAAGATTTTGCTATTTCTAATCAGC
GCTTGTAAAAAGATCTTACCACTCCTCGATATGGATTTCAAGACTGCCAGAAAGATCGTT
CAGAGCGACATAGAACTCGATCTATGCAAAGAGTATATTTCGAACCCTTAAGCAAAACCA
GGAGATAAAAAAGCTGGTGGAGCTTAGCAATTCATAGACGATGATTATTCAGATTTGCCA
ACTCTCCCACCAATCAATAATTTTGTATTCGCCACTGTTCCAGCCTTCAAATATAAAAAG
AACTTGTAAAATGTGTACACTTACATGTTGAAACATTTCTAATTCCAACCTGAAGATCCA
ATAAGTCAGAAAATTAAAGTCATTCAAAGAGAAGATATCGTTAACTATGCAAAACTTAAA
CAGTATATAACTGAGGAAGAGTCTCTCGACTTAATTGGTAAGTTAGGAACAGAAAAGATT
ACAGAAGTTTTTGCAAAGACAACTAATGACCTAATTATGGCTTTTGAAGTTGCCGCTAAA
AGAGCAAAAAGAGACAGCTAGCAATTAAATTAACAAGAGAGCACAGATGTTGAAACTACT
CTTTGGCTGAAAGATTTCCCTTAGACTTCCAATGAATTTAAGGCTTTTTATCAATATTAA
CAACATGCGAATCATATCCATTCAGTTATTGTCATGGAAGAGAAATTTATACCTGAAAGT
GAAGATGAAGAAATTCTTAAGTTTACATCTTAAGATCCAACATTGGAACGTTACTACTAA
GAGTAGGAAAGAAAAAGAATTGAGGAGAAGAAAAAAGTCGAATTCCTTGCAGATGAAAGA
ATTCAAGCATTTAATACTGTACTTGAAGTAGGAAGAATCTTTGCAAGCAGCCAAGGGGAT
AGTTAATTTAAACTATGTTCGGTGAGTAGAATAAAATTCTAGGGTCCAGATTCCTCGACT
ATCTTGCATGAAGAAACTTTGGATCCAACTTAACCTGCAAGCCAGCATATCCATCCAGAA
AATGAGTAACTATATTAAAAGTTTGCATAGGAATTTAAGTAAAATATTGATTAACAAGCC
AGTGATTTACAAGAATACAGATAATTGAAGAAGAATTTCTTAGCTTAGGTCTAAACTAAA
CCTTTAATGCCATATCCAGAGGAAATTTTAAAGAAAATGAGAATCGAAGAAGAAAAATAG
AAGGAAATTCAAAGGAAACTCGAAGAAGAAAAGAAAGCTTAGGAAGCTTTAATTGCTTAA
CAGTAAGCATAAGCATTAGCTGCTCAAAAGAAAGGTGGAGCTGCTGCAAAAACATAACCT
ACAGCTTAATAAAACACATAATCAAGAACTGCACTACAAAGTAGAGGTAATGATAGAGCT
GAGACTTAAAGCAAGTTTGAAGAATAGATGGCAAAATTTAAAGCGATGCCAAAGAGTAGA
GACGATGAAGAGAAAGATTGGAACTTTTAGCAATTTGAAAAAGTCATAGCTGAATTAAGC
CCAGAAAATGGCACTCCAGGAAATATACTTGCTGCCATGGTTTATTAAATAGCAAACTAG
AATAAGAAAGCAAAGGATAGAGCAATTACTGATATAGACAAACAATTCATTCTTAAATCA
GAGGACTAAGAAAACGATATCAATGATCATTTCGATGACATTTTTAACAAATTAGCTATT
GAACATAATGTTATTGAAACAACTTTCAAGCATCACTCTGATGAATAGTTGAATTAAAAT
AAAAATGAAAGTGTATCACCATATCAATCAATTTTCAATGAAAACGATAAAGTTAGCAAA
CTTGCTCATACTTATACATTCTTATCAGGTGATACTATTACTTCAACTGAAAATCTTGCT
CTTTAAAATTCAAAATTGCCTGGTATTAATAACAGATAAGACATGCCTTAACAACCACCA
ATTTAACAACCTTAAAGAGAATCAGATCTTAATGCTATTTTATCTTTTTCACCATTCTCA
GCTTCACAAACCAAAAGACTTCTAATTCTGCACTAAATGGAAAAGATGTTCAAGAATAAA
AATGCACATCCCGAAAGAGATTTCTTCTTTTTGGACCGTAATTTTGTTGAGAAATATGAT
TCCACTACACTTAGGTAAATACTTGTTTAGGCTTTGAGATATGGCCCTGATATGGTTCAT
CATTATGAGTAGAGGGAAGATGCTCTACTTCTTGGTATTTTTTACAAGAACCCTCCTGGG
AGATTATTGCGAAGATAATGGACTCATCCTTTGAAAGTCTTTCCAGATTATTAGGTGTGG
AAGAATTTCGTAAAGCATGATACTAACTAAGCATTAGACTTTTCTTAACTATATGATATT
GAATCTTCAAAAGTTGGTTTGATAAGAACTAACTCAAAATACTGTTTCCCTAGTGATAAT
AGCGTTATCAGAATCGATAAGCATTAAATTGGTAATAGAAGATATGGGGCATCTTTAGTA
GTAAAAGATAATTTAGTCTTCGGCATTAAAGAAAACTTAGAAAAGTTCAAACAAAAATAG
GGACTATTCGAAGATGAAATTTTGAATAGGGAGGCTTTCCCAACATCAGATAGAAGATGC
ACTTTCTGGTTAGAGTTTGAAAATGGAGTTAAGCTATAAGTTGAGATGTAAGAAAGACAA
ACCGCTCATTTAGAGGAGATTCCACTTCATGAGCCTCTACCACCAAATCTTGAGGAAGAA
GCCAAGAAAATGAATCAAACCAATACATCTATGATGCATGGTGGAGATGTCGCTGACAGT
TCTCCTCCCAATTTACAAATTGAGAGTGCACCAGTAGGGCAATCTAAACCATCAGGAGGA
TTAAACAAAAATGAAAGTACTAAATCAATTAAAAATGATGGAAAGCAATCTTAGCTTAAG
TAAAATCCACCAAGTGCAGCAACAGGTAAAAATGTACCAGCCTAACAATTGCAGAAAAGT
GATTCATAGAAATCTGTTGGTTCAGATAAATCTCAGCCATCCGGACCATCTCCTCAAGAA
TTAGCTCTAATTCAGAAGCAGAGAGACGAATAGACAAGGTTGATGTCAGCTGCTAGTAAG
AACCAATTCTTTCAAGACAGATATGATCCCACAGTAGGAGCTAAGCTAACTTTTACATTC
TAATAAGGCCTTATTGTTATGATTATGCCAAACGGAGATGTAAGCTAGTAAATAGTTGAG
AACTCATCTGAGAAAAAGAAATATGGTGGCACTTTACACTAAGATTCACAACCAGCTAAT
TTGCATGAAAAATCTAGACTGATAACCAGAAATGGTTAAGTCATTAGATATTTCTTAGAT
GGGAATATGTAAATATTTTATCCTGATGGAACAATCACTACAACTGACAAGAGAAAGGGT
GTGTGGTTTACTGTTAACACCAAAGGTATAAAGAGAGTCAGAAAATTGCATGATAATATG
GTTTATGATGAGCCTAAGAGATTGAAAATTACCGAGAAATTAGATCCAGAAACTAGTGCA
GTTGTTTAAGTTAGAGAGGATGGAGTGCTTACTATAAAGTATATTGATGAGAGCAGACTT
GTTATGATGCCAGATGGAACTTAAGTTTTGACTAAGAAAAATACTGAGACTGGAAGCGGT
ACTATAACTATAATTACAAAGCAAGGATTTGCACCAGTCAGATTGATTTTCGACCCTGTA
AAAGCAAGAGCAAAAACAGTAATTGGACTTGGTGGAGCTGATTCAATGATGGGTATAGAA
AATATCATGGAAAGAACCAATAATGGTAAAGTGACTGAGGTTCTTCTTCCAGACAAGACT
ACAGTGTAGAGTTATCAAGAAAGATAAGAACTTGAAGGTTATAACAATTTTACAACAAAT
CTAGTCCATTTGATTAAGAGAGATGATTTCTCGATAATTAAAGTAAGACAGGATGGTGAA
ATGGTACTAATTTCATCAAATTAAAGGGCTTTCTTGAATGAAATAGGGAAGAATAAGGAA
TTCGGTAAGAATGACTATGATCATTACTTCGAATTGTTTGGTGTACCTAATGAGAGAAGA
TCTGGTGTTTTCACAGTTAACTTAGACTAAGGTAGAATGATAACTTAGGACGAGGAAGGC
AATATTTTTATAGTTTATGCAAATGGGGATTCAGTAGAAAAACTTTCAGTTAGTTTCAAT
CTTGATCAAATGGTTGAGGGAATTGAAAAGAAAGAACCCGATTCTCCTAGAATATAAGAT
GGCGAATACATTGAAGAGGAATGCAAATTTTTACCACCTCCAAAGACAATTGCTCATCCA
AGACTATTTTTGATTAAGAACGATGTTGGCTATGAATTTTACAACCATGAGTAGCTGGAA
TATTTGTTCAGGTGCAACAATAAAGACACTTAATTAGTTAACTCAAAGAAGAGTGTTAAG
ATAGATAATGAGGAAGCTATTTCTCATATGTTCCTAAGATTGTCTCAAGATTTCAATCCC
AATCAAACCTTTAATGGATTGGTAGTGACTCCTAAAATCCCTTAAAGTGTTGAACTAGTA
AACCAGACTGTTTCAATTCCGAATATTCCCTTCAGAGAGCACTATGAATGGAGAAATATC
ATAGAATATAAGTCATTGGATGTGCCCAAACAAGTTTCAGAATTCAAGGACAGTCTTAAG
AGATACGAGTAGATGAAGAAGAGACAGCAAACCGAAAGTGATAGACTCAAAGTTACAGAG
ATTAAAACAGAAGAGCACAAGGAAAAAGAATGCAAAATATGGATGAGAATAGCAAGAGAA
AAAGGCATAGACATTTCAAATCTAGTGGGTGAGGAGTATAAACCACTCAAGGATGTTGTT
AATGAAGAAAAGAAATAAAAATTCTTAGATGATTTGGACAACAATTTCTTCTCTGATGAA
GATCAAGATAATGAGTGA


>Contig18196.0.g15(protein)
MPKNNKKKQTKDTKDPQKLKELGNKAFINKNYEEAIEMFSKAIEEDPTDPVFFTNRAAVY
LTIDKLDESVKDCDKAIEINKNFVKAYFRKAQALREKLDDLGAIEVLKAAIELDPENSDL
SKLLDQTRQEYEEDNSIPIDHPERQRFETLLKWLEQGGSHFEKLKIRYYTADYRGVHAAR
DIKKGEIILYVPKHQIITLEMAMTSPVGKKMYEKGLRQRLISPKHSFLSTYIMQEKRKPE
SQWQIYIDILPKNFSNFPIFFTEEERIWLKGSPFLDQILEKIEDIKADYDLICKEVPEYV
QFPIREYSEIRMMVSSRIFGIQIEGVKTDGFVAYADMLNHKRPRQTSWTYTDEKQGFIIE
AMEDIQRGEQVYDSYGKKCNSRFFLNYGFINLNNDANEVPIKVYYHTDDQLKQVKQDMIV
DHSEFKKFRVVENLEDRVMQEFFSWLRFVEYDENITLIYQYQGAAISKAQKYKRGDESDS
DEADDPSKGFKAKDLPPLSIRNEKLVLERIINLAKEAYDKYERTYEEDLKILEREDLTFN
HRNCLLYTSGEKKILLFLISACKKILPLLDMDFKTARKIVQSDIELDLCKEYISNPQAKP
GDKKAGGAQQFIDDDYSDLPTLPPINNFVFATVPAFKYKKNLQNVYTYMLKHFQFQPEDP
ISQKIKVIQREDIVNYAKLKQYITEEESLDLIGKLGTEKITEVFAKTTNDLIMAFEVAAK
RAKRDSQQLNQQESTDVETTLWLKDFPQTSNEFKAFYQYQQHANHIHSVIVMEEKFIPES
EDEEILKFTSQDPTLERYYQEQERKRIEEKKKVEFLADERIQAFNTVLEVGRIFASSQGD
SQFKLCSVSRIKFQGPDSSTILHEETLDPTQPASQHIHPENEQLYQKFAQEFKQNIDQQA
SDLQEYRQLKKNFLAQVQTKPLMPYPEEILKKMRIEEEKQKEIQRKLEEEKKAQEALIAQ
QQAQALAAQKKGGAAAKTQPTAQQNTQSRTALQSRGNDRAETQSKFEEQMAKFKAMPKSR
DDEEKDWNFQQFEKVIAELSPENGTPGNILAAMVYQIANQNKKAKDRAITDIDKQFILKS
EDQENDINDHFDDIFNKLAIEHNVIETTFKHHSDEQLNQNKNESVSPYQSIFNENDKVSK
LAHTYTFLSGDTITSTENLALQNSKLPGINNRQDMPQQPPIQQPQRESDLNAILSFSPFS
ASQTKRLLILHQMEKMFKNKNAHPERDFFFLDRNFVEKYDSTTLRQILVQALRYGPDMVH
HYEQREDALLLGIFYKNPPGRLLRRQWTHPLKVFPDYQVWKNFVKHDTNQALDFSQLYDI
ESSKVGLIRTNSKYCFPSDNSVIRIDKHQIGNRRYGASLVVKDNLVFGIKENLEKFKQKQ
GLFEDEILNREAFPTSDRRCTFWLEFENGVKLQVEMQERQTAHLEEIPLHEPLPPNLEEE
AKKMNQTNTSMMHGGDVADSSPPNLQIESAPVGQSKPSGGLNKNESTKSIKNDGKQSQLK
QNPPSAATGKNVPAQQLQKSDSQKSVGSDKSQPSGPSPQELALIQKQRDEQTRLMSAASK
NQFFQDRYDPTVGAKLTFTFQQGLIVMIMPNGDVSQQIVENSSEKKKYGGTLHQDSQPAN
LHEKSRLITRNGQVIRYFLDGNMQIFYPDGTITTTDKRKGVWFTVNTKGIKRVRKLHDNM
VYDEPKRLKITEKLDPETSAVVQVREDGVLTIKYIDESRLVMMPDGTQVLTKKNTETGSG
TITIITKQGFAPVRLIFDPVKARAKTVIGLGGADSMMGIENIMERTNNGKVTEVLLPDKT
TVQSYQERQELEGYNNFTTNLVHLIKRDDFSIIKVRQDGEMVLISSNQRAFLNEIGKNKE
FGKNDYDHYFELFGVPNERRSGVFTVNLDQGRMITQDEEGNIFIVYANGDSVEKLSVSFN
LDQMVEGIEKKEPDSPRIQDGEYIEEECKFLPPPKTIAHPRLFLIKNDVGYEFYNHEQLE
YLFRCNNKDTQLVNSKKSVKIDNEEAISHMFLRLSQDFNPNQTFNGLVVTPKIPQSVELV
NQTVSIPNIPFREHYEWRNIIEYKSLDVPKQVSEFKDSLKRYEQMKKRQQTESDRLKVTE
IKTEEHKEKECKIWMRIAREKGIDISNLVGEEYKPLKDVVNEEKKQKFLDDLDNNFFSDE
DQDNE