Identifiers and Description

Gene Model Identifier

Contig144.1.g7

Standard Name

SET2

Aliases

Contig144_1_g7

Description

SET domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005388506.998759398018207e-85SET domain containing protein
SGDYJL168C9.995528898049344e-31SET2 SGDID:S000003704, Chr X f
rom 104428-102227, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig144.1.g7(coding)
ATGGAAAATGATTCAGATTTCTATGATGAATACTCTTAAGAAACTGAGATAAATTAGCAT
AATAGTGGGATGATAAACGCAGTCAATCAGGTCAAACGAGCACACAATAGTTATTCCTTT
CCATTCAACGAGGCATTCGAACTCAAACGAGAAAAACTGAGGCAACAAGAATTGAAAAAT
CACCCAGAGAGATTTAGGCTGCTCGCGCACTCTTTGTCGCAGTTCATCCCCATCAAGAAA
AATAAATATTTGGAGAGAAAACGCTACGTCCTCAATGAAAAGGAAGCCAGCTCACTCCTA
GTTTGCAATTGCCAAAAAGCTACTTATAAGAAAAATGAGAAAACAAATCCACTTCAATCT
TTTAACTGTGGTGAGAGATGTATAAACCGATGTGTTTCAACAGAATGTTGCGCTCAAACT
TGTCCTAGTGGAGCTTTTTGCAAAAATCGAAGATTTTAATTACACCAAAATGCTTATGTA
TTTCCTGCCAAAACAGAGAAGAAAGGCTATGGTTTATTTGCAGGAGAGTTTATACCAAAA
GGAACTTTTATCATGTAATACGTAGGTGAAGTATTCTCGGTTGATACGGATCTTGGCTAA
TAGAGAGTTTTAGAATATCGCAAGTCAACCTGTACTTATCTGATGAGGACAACAAATAAT
GAAGTCATTGATCCCACATATGTAGGAAATGTTGCAAGATTTATAAATCATTCCTGTGAG
CCAAACTGTGAAACTCAAAAATGGAATGTTCTTGGAGAGGTGTGCGTTGGAATATTTTCC
TTAAGAGATATACATGAAAATGAGGAACTTTCCTTCGACTACTAATTTGATTTTTTCAAA
ACTCCATTTACTAAATGTTACTGTGGCACTTCGAAATGTAAGGGGTATTTGGGGGTTTTG
AGCAAAATCACTGATGATGAGGACGAAGAATTTGAGAATCCAACTTGCAATATCTGTGAT
GACTATATAAACGACAAGGATGATTTATTGGTTTGCAACGGGGCATGCAGGGAGACATTT
CACTTACTTTGTATAATAAAAAAAGAGGGAAAAACCAAAACTTAGGCATAGGCTCTAATG
TAGTAATCAGACCGCAGGAACTTCGTGTGCAGAGATTGCATAGTGAACTCAAGAAAGAAG
AAAAATAGGAAAAACGCCAAAGATTTACAGATGCAGGATGAACAGAATATCAATACGTCA
CTACTCAGAAATAATTAAGATGCTGGTTTTATTCTAGAAAACCCCTAAGAAGATAAAGAC
GATGTAATAAACTTGGAAGTTGAGGTCCCACCTTGGGAATCAGAAGACCCTCAAATCAAG
AAATTTTTTGAAGATAACCCTTAAAACAGGGATTTAGATATTATAATAGCAAGAGAAGCC
GAATAAATCGAATAAAATCTGAAAAGTATCAATGAAGCTGCCCAAACTGGAGGTACTGGA
AATAACAAGTTCAAAAGAGCAAAGAAGAAAAATAGTTAATTCAGTGAGCACTACAATTTC
ATCTCAGAATTGCAGAAAAGATTAAAAATGCGCATAGACGGAGATAAAAATAACTACAAA
TTCAGGAAATTCAAAGATGATATATAGGAGATGAAAAGAATGAAGCAGCAGTTGATTTAG
GCCAAGAAGTAGCAAAGATTACTTAAATAGATGGCTTTGGCTTAAAAACAGCAATAACAG
GCATTGAAAAATTAGTAATAATTACAGATTGCATAGACTATTAATTTAGAGCATAAATCT
CAGTCAGTATCTTAATAATTTATTGGGGTAATTCAATAAGAAGAAATTAGTGGAAAGAAA
AAGAGAGGGAGACCCAGAAAAATCTAATCTTCACTCTCCTTCAATAAAGTGAATTCTCAC
TTGCAGTAGCAAACATCAACTAGTTTGTTGCAAATCACTCAATCTTCGTAGTTTAGGCAC
TAATCAACAAACCTACAACACCCATAGCTACATCAAAGCATGAGTGTATAGATCACAGAT
ACACAAACAACTCAATTACTATTACAAAGTAGCAGTGCAGACCCCTTGAATCTTCAATTA
TCACAACCAATAAATGAGTAGCAAGAACTCCATAAAGAGGATGAAAGTGAGGAACTTAGA
GAGTTGATTGACACTTAAATGGATCATTAGTAAGTATAGAGAAGACAGAGACTGAGGAAG
TTAGAGGAAGAGGATGTAATAATGGAGGAATCACGGGAAGTTAATGAGCTAAGTCAATCC
AAAGCAGAGGTATAAGAAGAAGATATGGATGATGACTGTGAAGATGAAGAGAACGATGAG
GAAGACGATAACTCTAACACTTTATTTGAGGAAGTTGATGAGAACGAGGAGGATTTCATT
GATGAAAGCGTGGCAGCACAGGCTTTAGTGGATGAAGATGACGACGAAGAGGATGATGAC
GATGATGATGAAGACACTTTCAGCAATTAAGGTGATGAAGATAACATGGATAGCAATAAC
CGTGATGATGAACTAGATCTTGATAAACTCCAGGGGTAATACGAGGACTAGGAAGAGCAG
AAAGTGAGTTTTTCAGCGAATCAGCTAAATTCACAGAGGCGTCTGAGGCTTTAATCAGGA
AATAGCCTAAATGAAGTATATAATAACAGCAGAACCCCAATTAAAAACAGAAACTTAAAT
GATAAAAACATCAGTCCTAATAAGAAAGACACTTTAATGCAGATTGGCAGTACATCATAG
CAAGATCAACACAGTTTAAATGCAAATAATCATTTAAGTCTGGTTCAAAGAGAGAAATAG
AGAATTTTGACGCTGATTAACACAAAGATTAACGAATTTTTGAAGGAATAAATCATGGCT
AGCTCAGATACCTCACTAGCTCCCATTAATCCATCTGAACTTATAGTCAGAGAATCTAAA
TTCAACATTTTTGAGGCAGTGTTTAACATAGTCATTAGTGAAAACATTGACACACTGTAG
TGTTTGCCAACAAAATTCTAAATATTCTGGGAGTAGGCATGGGGTGGTATGGTGACAGTC
AGACTCCAAAGCACCCTAAAACAATACCAATTCCTCACTAATCTAATCTCTGAAGTCACT
GATTTAATGTATAAAGCCAAGCTATTCGCTTAATCATCAAGTGGTCTGTAAGGGATTAAT
GGAGTGTAGCAAAGTTTTGGTAGTTCCAGCGGCCATAATTTCAGTTCTAAAAGTGAACTA
CATTTCAATAAGAGTGATGGCAAATATCAAGTACCTTTTGAGATAGTGATGATGAAAGTG
CCAAAGAATTTTATCAGAAAACTTGTTGGATATCAAGAGAAAGTATTGACTGAATTTAGG
AAAAATTACCAAGTAGATTTTTATTTCGATAGAGATCTAATGACTGATGATATTTTCCAA
ATGAATGAGACCACTGAATTGCGCATTTTCGGCAGAAACCAAGATGTAGTTTAAGTGAAT
GAAATGATTTAGAGAGAGCTAGAATAGATAAAAATTAAAACAGTTTTACTCTAAATGAAT
GATTGCAAGTTGCTTATGGACAACGTCAAGGAAGTTAAGGTTTTATGTGACCCATGTGAG
ATAAGAGTGAAGAGAATGATGAGAGAATGGAAAGACTTGAGGCATCCATTTTACTATTTA
CCAAATTATTTCAGAGAAATGGCATTAATTGGAAAGGAAAGTGAAATAAAGTAAGCAGAA
AACAGGATTGATTAATTCTTCACTGCAAAGAGAGACATCAATTATGTGAATAATCAGCAA
ATCAGCTTTTTACTGCCAATTTACTTCAAAAACTTGAGTAGTGAAATGAAGGTGTAGCTT
AATACTAAGTGTTCCAAAGTCCAAGTATTCTTCTATGAGCCAACTTATCCCCGTAAACAT
TTGACAGTTTTAATGATAGGACCATGGAGTGCTTTACTCTAAGCAAAAATAGTGCTTGAG
GAATTGGCTAATGTCTATATGTTTAGAAATAACCACAGTTTTGAAAACTTCTAGTAGTTC
ACTTATCACCAATAAATCAGGTTTTCATTCAAGAGTCTGAAGAGATTTGTGCTTGAGAAG
GACATCAAATATCTGAATCACTGGGATTTATGCTCTATATTTATGGAAAATGCTGGTAAG
CCAGTTCCAAACTTTGATTGGTCAACTTTTCTTAACTAGTCTCAACCATCAAAAGGTAAC
TAAAATCAAATGTTGATGAACTCAAGCCATTAAGATGCGCTTTAACCACAAATTAGCAAT
CAGTCCTTCGGTTAATCATCCTCTTAAAACTTACTATTTCACCATTAGCAAGTTGCCAAC
TAACAATAAATTGAGCTTTTAATGAAACAAAGAGAAGATGAACGTTCGAAAGATTACTCA
GCCTTAATCGACTTTCTTAAGAATCAAGATATTGAGACTTGCATAAACAGTATATTTGTG
CTGAATGACTCAAACAACGCAGAAGAATCACTCAGAGAACTTATGACCAGATTGAAAGTA
AGCAAAAATGAATTGATACAGTTTATGGCTATAATGTTGAATAAAAATATTGGGGACTTT
GAAGACTCTATTAGAAGCTATGGAGCTAGATATGAACCCATTAAAATTATTCAATAAGAG
GCAAATGATGAGAGTGAAACTTTGATTATATAATAAAGTAGAGATGCATGTAGAAGACCA
AAGGGATACTATCAAACTTCATCTACATTTTACAAAAAGAGGAGCAAGAGTAGAAGTGAA
AGTTAGGTAAAATATATCTCTGGAGACCATAAATACAACACTGGCTTCGATTAAAAATCT
AGAGGATTAAGCCATGATTCTTCTATTGAAAATAAAAAGTCCAAGCCTAAATTTTCAAAT
TTTGACAATGAATAGATTATGAAATAAGAAAAGGAATCTAGCAGGAGTAGAAGTATTTCA
AGAAATAGAAGTAAAAATATGAAAAGTTCAGACTCAAATGAAAATAGCAGTGACAGTAGT
TCGCATGGTAGGTATAAATACTTTAGCAAAAATTACAAAAGAAATGCAGATAGCCCAGAC
TTCACAAGGCCTATTTAAAGGTTTTACAAAAGATCACCCACAAGAGAATATTCTGGTTAC
CATAAATTCAGGTATCACGGATCTTATAAGGATATTGTGAATAGCACTTATCGAAAAAGC
CATCATTCAAGGGAGAGTCCTAGCAAGAGCAGGAGTAGAAGCTATTCAAAGCATAAGCAT
CACTACAGCAAAAGCAAGTTTTCAAGACACTATGTTAAGCATTAATCAAGGAGAAGATCA
AGTAGCAGCTCCTCCTATCACAAAAAGCATTCATATCACCATGATAAGACTTCAGGGAGA
AAATACTATCAGTCATTTTATCATGGCGGAACACATCATAAGTATAGGGATGTTGATAGA
GCTTCAACTCGCTAAGAGATGAATCACGACTCCAACAAGAGATCAGATTCGAGCTCCTCA
CAAAATGAACATAAAAGTAGAAATCATTATAGCCATAGAAGCAAAAGTAGAGAAACTAGT
CATCATAGAACTTCAAGGTCTAGACATCAAAATCATCATACTTATCATAAAAGCAGTCTT
AGTCATCACTATAGCAAATCAAGAAGATAAGACTACCATGGTTTTGATTTCAGGCATAAT
TTTTCATCTGGAGGATTTGACTCTTAAAATTACTTCTCCAGTAATGGAAGTAGAGATCCA
TACCATAGCGTGAGAGCGCTTTAAGATCCAAATCGAAAGAAAAATCGTGGTGGATTTGAC
TACAATGCTGCAAACGATTCATAACAGAATAAATTAGTTCCTGTGAAGTCTACCAGTGAA
AATATGGTACAGGGACAGCCTGGAACATCTAACGAGGAAGGACAAATATGA


>Contig144.1.g7(protein)
MENDSDFYDEYSQETEINQHNSGMINAVNQVKRAHNSYSFPFNEAFELKREKLRQQELKN
HPERFRLLAHSLSQFIPIKKNKYLERKRYVLNEKEASSLLVCNCQKATYKKNEKTNPLQS
FNCGERCINRCVSTECCAQTCPSGAFCKNRRFQLHQNAYVFPAKTEKKGYGLFAGEFIPK
GTFIMQYVGEVFSVDTDLGQQRVLEYRKSTCTYLMRTTNNEVIDPTYVGNVARFINHSCE
PNCETQKWNVLGEVCVGIFSLRDIHENEELSFDYQFDFFKTPFTKCYCGTSKCKGYLGVL
SKITDDEDEEFENPTCNICDDYINDKDDLLVCNGACRETFHLLCIIKKEGKTKTQAQALM
QQSDRRNFVCRDCIVNSRKKKNRKNAKDLQMQDEQNINTSLLRNNQDAGFILENPQEDKD
DVINLEVEVPPWESEDPQIKKFFEDNPQNRDLDIIIAREAEQIEQNLKSINEAAQTGGTG
NNKFKRAKKKNSQFSEHYNFISELQKRLKMRIDGDKNNYKFRKFKDDIQEMKRMKQQLIQ
AKKQQRLLKQMALAQKQQQQALKNQQQLQIAQTINLEHKSQSVSQQFIGVIQQEEISGKK
KRGRPRKIQSSLSFNKVNSHLQQQTSTSLLQITQSSQFRHQSTNLQHPQLHQSMSVQITD
TQTTQLLLQSSSADPLNLQLSQPINEQQELHKEDESEELRELIDTQMDHQQVQRRQRLRK
LEEEDVIMEESREVNELSQSKAEVQEEDMDDDCEDEENDEEDDNSNTLFEEVDENEEDFI
DESVAAQALVDEDDDEEDDDDDDEDTFSNQGDEDNMDSNNRDDELDLDKLQGQYEDQEEQ
KVSFSANQLNSQRRLRLQSGNSLNEVYNNSRTPIKNRNLNDKNISPNKKDTLMQIGSTSQ
QDQHSLNANNHLSLVQREKQRILTLINTKINEFLKEQIMASSDTSLAPINPSELIVRESK
FNIFEAVFNIVISENIDTLQCLPTKFQIFWEQAWGGMVTVRLQSTLKQYQFLTNLISEVT
DLMYKAKLFAQSSSGLQGINGVQQSFGSSSGHNFSSKSELHFNKSDGKYQVPFEIVMMKV
PKNFIRKLVGYQEKVLTEFRKNYQVDFYFDRDLMTDDIFQMNETTELRIFGRNQDVVQVN
EMIQRELEQIKIKTVLLQMNDCKLLMDNVKEVKVLCDPCEIRVKRMMREWKDLRHPFYYL
PNYFREMALIGKESEIKQAENRIDQFFTAKRDINYVNNQQISFLLPIYFKNLSSEMKVQL
NTKCSKVQVFFYEPTYPRKHLTVLMIGPWSALLQAKIVLEELANVYMFRNNHSFENFQQF
TYHQQIRFSFKSLKRFVLEKDIKYLNHWDLCSIFMENAGKPVPNFDWSTFLNQSQPSKGN
QNQMLMNSSHQDALQPQISNQSFGQSSSQNLLFHHQQVANQQQIELLMKQREDERSKDYS
ALIDFLKNQDIETCINSIFVLNDSNNAEESLRELMTRLKVSKNELIQFMAIMLNKNIGDF
EDSIRSYGARYEPIKIIQQEANDESETLIIQQSRDACRRPKGYYQTSSTFYKKRSKSRSE
SQVKYISGDHKYNTGFDQKSRGLSHDSSIENKKSKPKFSNFDNEQIMKQEKESSRSRSIS
RNRSKNMKSSDSNENSSDSSSHGRYKYFSKNYKRNADSPDFTRPIQRFYKRSPTREYSGY
HKFRYHGSYKDIVNSTYRKSHHSRESPSKSRSRSYSKHKHHYSKSKFSRHYVKHQSRRRS
SSSSSYHKKHSYHHDKTSGRKYYQSFYHGGTHHKYRDVDRASTRQEMNHDSNKRSDSSSS
QNEHKSRNHYSHRSKSRETSHHRTSRSRHQNHHTYHKSSLSHHYSKSRRQDYHGFDFRHN
FSSGGFDSQNYFSSNGSRDPYHSVRALQDPNRKKNRGGFDYNAANDSQQNKLVPVKSTSE
NMVQGQPGTSNEEGQI