Identifiers and Description

Gene Model Identifier

Contig20462.0.g58

Standard Name

SET1

Aliases

Contig20462_0_g58

Description

PHD-finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_013091307.002264059090237e-38SET domain containing protein
SGDYHR119W4.00073564232477e-35SET1 SGDID:S000001161, Chr VII
I from 346043-349285, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20462.0.g58(coding)
ATGGAGGATTTCCCAGAAATCGATATGAGTATCGGTGAATATTATAAATTATTATTGGAA
GGTCGAAGACCCATGAGAAATCGAAATGCCCGCACCACCGTAGGCAATGATTCAAGCACG
AGAAACAGAGATGCCCTGCCCACATCAATAGGCGATATTGCAGGCTCCTCAAGATTAAGA
AGAAATGATCATTAATTAAGCGCCAATAATTCTCACAATCGAGTGAACCAACTCAGACGG
AGAAAAGGGTCAGACTCGTCATCTTAAGAGTCAGAAGAGGAGAAGAAGTCACCAGTTAGA
AGTGGAAGAGATTCGTAGAATAAGGCCGGAGGACTCTCTTTTCAAGTCAAAAGAAGCCAG
AGCTCTGGCTAAACACTGGGCAATAAAAAGAGATTAGAGAAAGCAAAAGATAAGCTAGGT
TCAAAAAAAGGAGGAACTATTGGATAGTAAAATTAGCTCAGACATCATGGTAAACCCACT
AGAAGTCAAATGACTCTGTCTAATACCATTTCTGTTAAAAAGTCAAATCTTCTAAGAATT
TAGGATGATGGAGGGGGTATTGGATCAGATGTTCTCAGATTGTAGTAACAAACTAACTCT
ATGATTTAAGATCAGATTTAAAAGGAAAAGGCGCTAAAAGAGGCATAGAAACCTGAAAAG
GATCTTTCTTAGGAAAGAGAGCCTCAATTTGAGAAACATAAGGAAGAAAAGAAAATTGTT
GAGAAGTTTGAGTATATTGATCCACATCCATTGTATTGTGTAGATAGATATGTTATTAAC
TCAACCTAAAACAAATCAATCCAAAAGATTGATAAAGTTGATGAAGCCACTTTCGAGTTA
AAAACGAAATCTGAGGAATCTGGTCGCCGACAACAACTAATTTTACTTTCGAAAGTCTTC
TTCGTGAAAATCCAAATGCTTGAATCTGTACCAGCCTAATTACAAGAATAGCTTATTAAA
GGCTCTAGTTAAACTGAAAGCAATATAGTCATTATCTAGAAGCTAACTAAAGGCAGAGAA
GATAATTAGGTTGACTTTGTAACACCCATTTAGCTACAAAATGGTAATTATTAGGCAGTA
GACATTAAAATAAAAGAGCAAATTAACTACTAAAAAGACTTGAAAGACTTTGAAGCTGAA
GTACTTGGACCTTATTTAAAGTCAGCATATAACAAAGAACTTACTAATTAAATCTCTGAA
TTTGCTGATAAGGTTTAGAAGTCATTTATGAGCTATTTTAATGACGTTAAAGCGATAGAG
TTGAATAAAAATAACTTAGAGTCTTTACTTTTTAGTATCGTAAGCTATGAACCTATAAGT
GGAGACAAATCATAACAAAGGCAGAAATTAGGAATATTTCTAAGAGCTAAATATGATCCA
TTTTACTAAGACTATGTGGTTTTTCTTAGACTGCTAAATTGCAAAGTAGCTCAAAAAGAA
AGAACAGATTGGTTCCCTCTTTCTAAGTTTTCAATTAAGGCTGACCTCACAAGAGGCTTT
GTTTCTTTAGATTACCTTTCAAGTCTTGAGAATATAAACAATGCAACATAAAAGCTTAAG
ATGAGAATGTTTGAGATGGTTAGCTTCTAGGAATCTCAATTGTAACAAGCAACATTGAGA
AGCATCTCAAATGTTTAAGATCACTCAGAAGGAGAGAGACCAGCTAAAACAACCATAGAA
GCCAGAGACGAAAGATGCTCAACTTGCAATTACATTACGAATGATATTGAACATTTAAAG
TGCAGTAATTGTTCAAAGAACTATCATTTATAGTGCCTTAAACTTCCAAATATTCATTCA
AATTTAGGCTTAAGAGAGACAGACTGGAGATGCTAAGATTGCATAAGATGCACTAATTGC
CTATCTTTAAGAAACAGAGATTCAATGCTAATCTGTCAAAAATGTAATGCTGGTTTCCAT
TATGATTGCCTTGATTAAAGTGTTAAATAAGGTGTTCCTTCAATTAGTAATGAGAAGGAC
TTAAAGCTTGGAATTGAAACAAGGAAGACCACATATTCCTAATTGAATCAGTTCTATAAG
TGCGAGTAATGCGTAGAATGTGAAAATTGTGGATCTAAAGAAGCTGGAGAGAAGAGAAAC
AATAAATGGTCAAAAGATTACAAACTTTGTACTACTTGCAATAAGAAAAGGTCTAACAAA
GAGTTTTGCTTAGTTTGTGAAAAATTCTGGCCTGATACTAAAGAAAAGCAAGATTAACTA
TAGACTATATAATGTGTCCAATGCTTAATGTGCGTTCATTAAGACTGTGATAGAATCTTC
AAGAATCCAAATGTTCTTCAATAGTTCAGTGATGGTTCCCTTAAGTATAATTGTTAAAAA
TGTAGGTAGAATGTTAGATTGAGATTTATTTCAGAAATAATCGAGAAGTTGGCATCTGAA
GATAAAATGTACTTCTATTAAGAACCTGTTGAGGGAAGGGTTCAAAATTACACTAAAATT
ATAAAGACACCAATGTGCTTTAAATATGTGAGGGAGAAGATTTCAGAGTATGTGAGAAAC
CCAGAGATACTGAAATCAGATATAAATTTGATATTCTAGAATGCAATTACCTTCAATTAA
CCAAAGCATAAAGTGCACAAAGATGCTATAAGAATGAAAGACTTATGCAATAATATTCTC
TCTAAATTCTGGGGAAGAATTGAAAAGAACAAACTTAGGACTCTTGATGAAGATTCACAT
CAGCAAAGAATAGTGGAGGAAATAAATGCTACAAAACAAGGAAAGAATTACAAAATTTAA
CCAGATGAAGAAGTTTTTATGCTTCAAGCTGAGGACCTCTTAGAGCCCTCAGAGCATATC
TATAATTTCCCAGTAGGTCCAAGTTCATCTGCAAAAAGTAACTTCGCCTCAAATTAGTTA
AGCCAGAGAAAAGATGACCAATTTGCGAATATGGATGAAAGTGAAAACGACTAAAATTAT
GTTGCAAGGAATGCAAGAGACAAGATGTTTGGCGCCTAAAATAGTAGTGTAAATGTTAAT
GCTGATGTTGACATGGAGAGTGACGATTAAAATGCATCACCAGGAAACAATAATGACCCT
CACAATTTGCTAGAGATGAGAGACGCTAATTTAGGAATTTCTAAGAATCTTAGAGTGAGG
AAGTAGATAAACTACAATGAAGACAGATTGTTAGCCTAAGGAAGCGGCATTCTAGGTCAA
TCTTCTAATGATTAGGCTTTAAGCGGCAATAAAAGGCAATTCTCAAATGCTTTTAAGTCA
TCAAGCAACATTGAAGTAGACTAGCTAATTCCACCTCTTTCAATTGCAGGAAACTCAATA
AAGAATTTGAAAAGGCAGAGGCAAAACCAGTTCAAATTGGATCCAGACTTTATTCCACCT
GGCACTTCAACAAACTTCAAGCCACAATCTTCAGCTGCCAGTCTCTTGACTTAAGCTCTC
AACTAGGACAATGCCTTAATTTCAAGTGAAATTAACAATGATAGAAATGAGACTAAAGCT
GTTGATTCTGTCCCAGTCAATCATATTTAGTAGCAATAGTAAATGATGATGAGCTACTAT
CAAGAGATTGATGATGAAAAGTGCTATTACTCCAACCCTGCGAGATGCTCATTTGACGAC
CCATCTCTTCTGTTCGAAGAAATGTGCTATCTATGTGGATCTTTTGGTAATGGAGAAGAT
TTTCTCTCTTGCACTTTATGTGGTGAGTCTTTTCATACTTACTGTTTGTAACTTCCTGAA
GATCAAGTTTCTAAGTATCAACAATATTGGAAATGTCTAAACTGCAAGTTCTGCGAGATT
TGTGCTTCAGCTACATAAGAAGCCTTTTTACTTTATTGTGATGTTTGTGACAAGGCTTTT
CACTCCTTCTGCTTAAAGCCTCAACTAAAAAGTATCCCTAACTGTTAATGGAAGTGTTAA
GAATGCTTTAAATGTTAGTAATGTGGTACGAAGGAGTTCTTTAGTGCCAAAGATAATGAA
GAAAAACGAAACTTAGAAGTTACTGACTTTGAATTCTCACAAAATTTTTCATTTTGCTAT
CAATGTGGTAAAAACGAGTACAAGAAGTCTTTCTGCAAAATATGCTAAAAGAAGACTGAA
GATTCAGATTCAGAATCTAAGCAAGAAAATCCTAGAAAAAATAAGTCAATTCATAGTCAT
TCTTTAGCTTTGCATTAAAGATAATCTAAAAGCAAGAAAAAGAGTCTGTAAGATTAAATG
ATGAAGTGTAACGAGTGTGGATTCTATTCCCATTTCAGATGTTCAAAGCTACTACCCCCT
GCTCTGGGGGAAATCAGAGATCAGGATATAGAAACCAATCCAGAAATCTTGAAAGAGTAT
AAATGTTTGGAATGCCTACTAGCTGGCAAAACTATTAATCATTTAATTAGAGAGACATGC
GAGCAGTATGAAAATATTCATCAAATCATTTCAAGATAAAAACTGTTGGCAAGCTTATGC
TCAGACATACTGTCTAAATACTTCCCTATCTAGGATAAGGCACCACTTTTTATTAAGAGC
TTTATCACATAGAATTATGACTTTTTCAGAAAGGATAAGCAAATTAATGATTGGCTAGAG
TTACTAGAGAGCAATGTTTGCCTTGAAAGTGCAGATTAGGGAACTTAGGATACTGAAAAA
ATGCAGGATTTAGATGAAGATGTATAAGAAAATTCAAAACTACCTGATGATGATTAAATT
GCAAGTGCAATCAATCAAGAGGAGAGAGAATCACCCTAAATCACTAAAGTGACTGTTTAA
GATGGATAATAAGAACGAATGAATATTGAAACTTCGATTGCAAATTAAAATGATTTCTCA
AAACAATAAAAGCAATTTTCTGATGTTCATTTAGAAGAGAGCCTCTAGAAGTTTGATAAG
AATTAGATTGAGAAGAATAAACCTTAAACGAAAGCAATGCAAGTTTATGACGATATGTAT
GGATGTAAGCAAACATTCTTGCCAGAAAAGAGAAATTTATACAAATCCTTGAGTTAAGGA
GATTAACATCGTTTTGGCTAAAGAGATCTCTTTATGTAACCATCAGAACTATCGAAACTA
ATCACGGTTCCTACTGAAGAAAATCTAGCAAAGATCAACTTCTCAGAGCTTTATGTGCAG
GTAGAATTCAAAGCAGTAATGAGGATAAAGTTCCATTTCTTTAAATGGTTTGAAGAACTA
ATTAAGCAAATCCTTAGAAACAATTCAAAATTCATTAAAACAGATAAAAAGATAAGTGGC
GAAAATCCTAAGAAATCAATCGAAGAATAAGAAGACCTTGAATAAATTGCATTCAATTAT
GATTAAGTTCAAATTAATACACTTTCTTAGAAGAATCATGCCTCTGAAGATGAGCTTTGT
ACTTTAGAAGACACTCTTGTATAAAATCCCTAGGTAAAACTTTAATGTGTTTTGTGCAGA
TTATTCGGAGAGTACACAGTTACAGGCAGACTTATACCATTCTAAGTAAACTAATTTGTT
CATGTAAACTGCGCTGTATGGTCCACTGATGTGTATGAAATTGGGGATGGATAACTTGTA
AATTTTTTCTTTGTTCAAAATGGAAAGTCTAGAACTACTAAATGCGTAGTCTGTAATGAA
ACAGGAGCTACAGTTATATGTTTTACAAGAAAATGTAACTAAGCATTCCATTTCCCTTGT
GCATATAGGGAAAACAGAGTAGCATTCTTAAGATCCAAAGAAACTTACTGCGACTATTGT
ACTAAATCTAGGGAATTCTAAGTTGGATATTTATAAGATATGACTACTAAAAGAAGGTTC
TAAATTGCTAGAAATCAAATTCCTTGGAATATGTCAATAATGTACTAACCTCCTCCAGGC
TAACAAGTCAATCCTTTCTTAATGAATACTTAGCTCTTTGCACTGTAACAAACTTAAGTT
GCTTTGAATAATGTTTCCAATCCTACAGATATGGAGAAGCCTCTCTAAATTGAGAAATGG
AGACCATTCTATTTTGATATGTTTAACAGAGTTGGTAATTTGACTGTGCTTAGTCTGAAG
AAGGAAATCAATTTTATCATAGAGGAGACTATCTATGGAACCAAGAAAGAGATAAATATG
GACGACCTTACAGATTTTGCAGCCATAAGAGTCTACTGGAAATTCTACAAAGATTATCTA
ATGAATGACTAAGAAGAAGAAAGTATAAATCCATTAAATCTTAGAAAAAGCTACTTCATG
TTTAGTAATAACACTATAAGAGAAGTCAATAAAAATGATTTGAATTCATTAGTAAATTAT
TCAAGTGAAAAAATAAGGGAAAAGATATAAATTGGTATTCACTATAACCAAGCAAAAAAT
TTATAAATTCACGTTGACGAAGGGGCAATGACTCCAATAAACTAAACCATGTTCTGGCAA
AAGATAATGCAACATTTTCAGAGAGAAAGACCTAACTTTACTCTTTAAAACATCATATTT
TCAATATCAGAGTTTGGAGGAAAGACGAAATATCCCATTTCAGTTTGGAATAGAGCAGAA
GTCAAAAACAAAGGATTTTTCTTGAAAAGTGGAAATTAAGTACTTTCTCAACAAAATCAA
ACACAGGATAGAGATAGCTAAACTTAATAATCTGCAAAGAAATTTGAGGGTAAAACTGTT
GATGATATTTTTAAACGAATGATAAAAATTAATCAAATGGGGGATAATTAAAATCCAATG
ATATCAATGAAGAGACTTACCAGCAGTAAACATATGAAGTATGAAAATATGTTGAGTACT
TTGGGAAAGAAAATGTTCTACTCTAAGAGTCATCAAGATGAAATTAATGAGAATAAGAAT
CAATAAAAGTCTACTGTCCTAGCAAAGAAGATCAGACTTACTGATACTATCGATACTAAC
AAGGAAATAGATCTTCCAATTGCAATGAAATACAGATTGAGTAAAGCTTAACCAAAGAGA
GTTGAAGTAGGGCCTTCAAAAATTCATAGAAACGGTCTTTTCACTCTAGAAGATTTAATG
CCTGGTGATATTGTGATTGAGTATGTTGGAGAAAAGATCAGAAACAAAGTTGCAGACAAA
AGAGAAATTTATTATGAGCAGAAAGGCATTGGTGATTGCTATTTATTCAGATTAGATAAG
GAGTACATCATAGATGCGACATTCTTTGGAAATAAAGCGAGGTATTTGAATCACTCTTGC
GATGCAAACTGCTCTGCCAAGATTATTAATGTGCAACAGTAAAAGCACATTATCATTTCA
ACTAATAGATAAATCAAGTCTGGAGAAGAACTTACATACAACTATAATTTTGATTATGAA
ACAGATAAGATAGCATGCTTCTGTGGTGCACCTACTTGCTCAGGAAGACTTAACTGA


>Contig20462.0.g58(protein)
MEDFPEIDMSIGEYYKLLLEGRRPMRNRNARTTVGNDSSTRNRDALPTSIGDIAGSSRLR
RNDHQLSANNSHNRVNQLRRRKGSDSSSQESEEEKKSPVRSGRDSQNKAGGLSFQVKRSQ
SSGQTLGNKKRLEKAKDKLGSKKGGTIGQQNQLRHHGKPTRSQMTLSNTISVKKSNLLRI
QDDGGGIGSDVLRLQQQTNSMIQDQIQKEKALKEAQKPEKDLSQEREPQFEKHKEEKKIV
EKFEYIDPHPLYCVDRYVINSTQNKSIQKIDKVDEATFELKTKSEESGRRQQLILLSKVF
FVKIQMLESVPAQLQEQLIKGSSQTESNIVIIQKLTKGREDNQVDFVTPIQLQNGNYQAV
DIKIKEQINYQKDLKDFEAEVLGPYLKSAYNKELTNQISEFADKVQKSFMSYFNDVKAIE
LNKNNLESLLFSIVSYEPISGDKSQQRQKLGIFLRAKYDPFYQDYVVFLRLLNCKVAQKE
RTDWFPLSKFSIKADLTRGFVSLDYLSSLENINNATQKLKMRMFEMVSFQESQLQQATLR
SISNVQDHSEGERPAKTTIEARDERCSTCNYITNDIEHLKCSNCSKNYHLQCLKLPNIHS
NLGLRETDWRCQDCIRCTNCLSLRNRDSMLICQKCNAGFHYDCLDQSVKQGVPSISNEKD
LKLGIETRKTTYSQLNQFYKCEQCVECENCGSKEAGEKRNNKWSKDYKLCTTCNKKRSNK
EFCLVCEKFWPDTKEKQDQLQTIQCVQCLMCVHQDCDRIFKNPNVLQQFSDGSLKYNCQK
CRQNVRLRFISEIIEKLASEDKMYFYQEPVEGRVQNYTKIIKTPMCFKYVREKISEYVRN
PEILKSDINLIFQNAITFNQPKHKVHKDAIRMKDLCNNILSKFWGRIEKNKLRTLDEDSH
QQRIVEEINATKQGKNYKIQPDEEVFMLQAEDLLEPSEHIYNFPVGPSSSAKSNFASNQL
SQRKDDQFANMDESENDQNYVARNARDKMFGAQNSSVNVNADVDMESDDQNASPGNNNDP
HNLLEMRDANLGISKNLRVRKQINYNEDRLLAQGSGILGQSSNDQALSGNKRQFSNAFKS
SSNIEVDQLIPPLSIAGNSIKNLKRQRQNQFKLDPDFIPPGTSTNFKPQSSAASLLTQAL
NQDNALISSEINNDRNETKAVDSVPVNHIQQQQQMMMSYYQEIDDEKCYYSNPARCSFDD
PSLLFEEMCYLCGSFGNGEDFLSCTLCGESFHTYCLQLPEDQVSKYQQYWKCLNCKFCEI
CASATQEAFLLYCDVCDKAFHSFCLKPQLKSIPNCQWKCQECFKCQQCGTKEFFSAKDNE
EKRNLEVTDFEFSQNFSFCYQCGKNEYKKSFCKICQKKTEDSDSESKQENPRKNKSIHSH
SLALHQRQSKSKKKSLQDQMMKCNECGFYSHFRCSKLLPPALGEIRDQDIETNPEILKEY
KCLECLLAGKTINHLIRETCEQYENIHQIISRQKLLASLCSDILSKYFPIQDKAPLFIKS
FITQNYDFFRKDKQINDWLELLESNVCLESADQGTQDTEKMQDLDEDVQENSKLPDDDQI
ASAINQEERESPQITKVTVQDGQQERMNIETSIANQNDFSKQQKQFSDVHLEESLQKFDK
NQIEKNKPQTKAMQVYDDMYGCKQTFLPEKRNLYKSLSQGDQHRFGQRDLFMQPSELSKL
ITVPTEENLAKINFSELYVQVEFKAVMRIKFHFFKWFEELIKQILRNNSKFIKTDKKISG
ENPKKSIEEQEDLEQIAFNYDQVQINTLSQKNHASEDELCTLEDTLVQNPQVKLQCVLCR
LFGEYTVTGRLIPFQVNQFVHVNCAVWSTDVYEIGDGQLVNFFFVQNGKSRTTKCVVCNE
TGATVICFTRKCNQAFHFPCAYRENRVAFLRSKETYCDYCTKSREFQVGYLQDMTTKRRF
QIARNQIPWNMSIMYQPPPGQQVNPFLMNTQLFALQQTQVALNNVSNPTDMEKPLQIEKW
RPFYFDMFNRVGNLTVLSLKKEINFIIEETIYGTKKEINMDDLTDFAAIRVYWKFYKDYL
MNDQEEESINPLNLRKSYFMFSNNTIREVNKNDLNSLVNYSSEKIREKIQIGIHYNQAKN
LQIHVDEGAMTPINQTMFWQKIMQHFQRERPNFTLQNIIFSISEFGGKTKYPISVWNRAE
VKNKGFFLKSGNQVLSQQNQTQDRDSQTQQSAKKFEGKTVDDIFKRMIKINQMGDNQNPM
ISMKRLTSSKHMKYENMLSTLGKKMFYSKSHQDEINENKNQQKSTVLAKKIRLTDTIDTN
KEIDLPIAMKYRLSKAQPKRVEVGPSKIHRNGLFTLEDLMPGDIVIEYVGEKIRNKVADK
REIYYEQKGIGDCYLFRLDKEYIIDATFFGNKARYLNHSCDANCSAKIINVQQQKHIIIS
TNRQIKSGEELTYNYNFDYETDKIACFCGAPTCSGRLN