Identifiers and Description

Gene Model Identifier

Contig11425.0.g28

Standard Name

SEPSECS

Aliases

Contig11425_0_g28

Description

Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam05889 ) Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen)
  • ( pfam01212 ) Beta-eliminating lyase
  • ( pfam00282 ) Pyridoxal-dependent decarboxylase conserved domain
  • ( pfam10836 ) Protein of unknown function (DUF2574)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007036507.998067676296916e-161soluble liver antigen/liver pa
ncreas antigen ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11425.0.g28(coding)
ATGGAAAGTACAGCAAATTAAGTAAAACAAAAATCTTAGAAGCCAGAGAATACTTTCTTC
GAAAAAGCTAGTGAAATAGTGGGTGTGGGTTATGCTAAATTAGCTCAATAATCTGTGTAG
ACCAGTGAGAATTTAATTATGGATTTGCTAAATCATAGATCTGTACCTAAAGAAGGATTT
GATGAGTTAACCATAAACACTCTCTTGAACAGGATAGCAATGATGGATTCAAATAATTAC
GCAGGAAATTGTGGCGTGGGAGAAAGAGAAGCAAGAATATTTAGTTCAATAGTAAGACAG
AGAAACTTCGATTTGGGTCATGGAATCGGCAGATCAGGGGATGTCCAAGCACTCTAGCCC
AAAGCAATTGGGTCTTCACTAGTAGTCAAACTTACAAAAAACATGACAATAAACGCAATG
AATAAGATACTAGGATACACTTCAATTAAAGATGCCTTAGTTTTACCCTTTGCAACTGGT
ATGTCACTTACTATAACTTTATTAACTATGAAAAGTTTAAATCCATAGGCTGAATATGTG
ATTTTCCCTAGAATTGACCAGAAAACCTGTTTAAAATGCATTTACACTGCAAACTTGAAA
CCCTTAATTGTAGAACCAATCATCAGAAATGATGAGTTAGGAACAAAATTAGAGGAAATT
GAAAATATTCTCAAAAATCCTGATTTTTAAGGCAAAATATTATGTGTATAGAGTACTACT
AGTTGCTTCGCTCCTAGAGCTTATGACAACATCATTGAGATAGCAGAAATGTGCAAAAAA
TACTCAGTTTTTCATTTAATCAATAATGCCTATGGTTTACAGTGTACAAGACTCGCTAGT
GATGTGACATAAGCAACTCTAAAAGGCAGAGTAGACGCTGTAATATCGTCAACAGACAAA
AATTTCATGGTTCCTGTTGGAGGCAGTATCATATACTCAGCCAAGAAAAAAGATTTAATA
GAAAAAATCAATAAATTTTATCCTGGTAGAGCCTCAGGTGGTCCAACATTTGATCTTTTC
ATTACCTATCTACAAATGGGAGCTAAAACACTGAAAGCATTAATAAAGGAAAGAAAGGAG
AATTTCGAATACTTAAAACAAAAGTTAAACGAGGCTCTCCCTCTATACAATGAACGCATC
CTGGATACTAAAAATAATAAAATTTCAATTGCTGTTACTATCAATAATCTAAATGATAAG
GTTTTCAAGCCAAATAACCTCAATGCGACATTCTTTGGAAGTTACTTATTTTCTCGCAGA
GTATCTGGAGTGAGAGTGGTTAATTCATCAAATGGAAAGAAATGTGCCCCTATAGGCCCA
GATGAAAATTCTACATTTTATAACTATGGCAGTCACTGCGAAAATTACCCATTTTTACCA
TATTTCACTACTGCAGCTGCAATTGGGTAGAAAAGAGAGGAGATAGATTTATTCATTATT
AGGATGAGAGAGGCTTTTGAACACTTCCTGAAAAATGATCCAACTAAAATATTGATGAGT
GAGGGATTAATTGAGAGGTAACTTGAAAGTTAAGAGGAAGAGAAGGAATCATAGAATAAA
CCATAAATAAATTAAAATAATTGA


>Contig11425.0.g28(protein)
MESTANQVKQKSQKPENTFFEKASEIVGVGYAKLAQQSVQTSENLIMDLLNHRSVPKEGF
DELTINTLLNRIAMMDSNNYAGNCGVGEREARIFSSIVRQRNFDLGHGIGRSGDVQALQP
KAIGSSLVVKLTKNMTINAMNKILGYTSIKDALVLPFATGMSLTITLLTMKSLNPQAEYV
IFPRIDQKTCLKCIYTANLKPLIVEPIIRNDELGTKLEEIENILKNPDFQGKILCVQSTT
SCFAPRAYDNIIEIAEMCKKYSVFHLINNAYGLQCTRLASDVTQATLKGRVDAVISSTDK
NFMVPVGGSIIYSAKKKDLIEKINKFYPGRASGGPTFDLFITYLQMGAKTLKALIKERKE
NFEYLKQKLNEALPLYNERILDTKNNKISIAVTINNLNDKVFKPNNLNATFFGSYLFSRR
VSGVRVVNSSNGKKCAPIGPDENSTFYNYGSHCENYPFLPYFTTAAAIGQKREEIDLFII
RMREAFEHFLKNDPTKILMSEGLIERQLESQEEEKESQNKPQINQNN