Identifiers and Description

Gene Model Identifier

Contig9372.0.1.g13

Standard Name

SEN1b

Aliases

Contig9372_0_1_g13

Description

AAA domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000113406.00277790667473e-79conserved hypothetical protein
SGDYLR430W1.0002012508493003e-67SEN1 SGDID:S000004422, Chr XII
from 993434-1000129, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9372.0.1.g13(coding)
ATGAGCATTCAGCCAGAGCTATACAGGTTTCATGAGTAAAATGAAGACGATAATGAATTG
TTCAGAGAGTTTGAAATGCAAGAGTAGCTTTTAAAGTAGCAGAAAATTAAGCAAATTCAA
GATAAAATGCTAGACCTTAAAGCCAAGAAATAAAGAATTAGTACTGACTCAGATTCAGAG
ACAGAATCCGAAGATGATCTGACTGAGTAGTTGAAAAACTTTCGCAATTAAGATAAAATA
TCTGACCAGAAAAAGCTATTACAATCGAAGTTGCAGGGAGATGGAAGTGGACGCAAGAAT
TTGTTGGACATTTTAAACTCAAACGATGATGAAGGCATATCACCATTGAAGAATCAGAAA
ATGAGAGGGATGGGAGGTGATCCATTGAGTTTAAATCTTGGTCTTACAGAAAGTGAGAAA
AAGTTTGACTCCATCAGGAAATAGTACGAGTTATCTAGAGGACTTGAGTAAAAGTCAAAG
CAAGATAGTGTAAAAAAGCAAAAGACAGATGAGTAAATAAGACTTGAGAAGATAAAGTCA
GAAGCCAAGAAACTCGAATTTATGGAATTATTTGGAGATGATTAGGATGACAAGAAAGAA
GAGAAAAAGGAGGGGCTAAAGCTTGACTTCCTCTAATTAGAAACAGTGAGTCTACCATCT
TAACATGGCTAACCTCTTCAAAATAAGTCTTTCTTAACTAAAGATTAACAAAGGAAAAGT
TTGATGTCTCATTAGGATTCGCTTTTCTATGAACAGAGAAGATAAAACAAAAAGAACATT
GACTCATTCATAAGATCAATTCTTAACCTCGACATCATAGACATGTTTAAGAATCAACCC
TTCTTTGAAAAAATACCAGATGATTTCCCTCAGGGACACCGCTAATACTTGAGAGTTTGG
GAGAAACTTTTCATGTATGAAACCTACAACATCATAGTAAACTCAAAGAGAAGTGAAGAA
AAAGTATCGACTTAATTCGAATAGTAGAGAAGACCATAAAAATCGTTGTCTTGGGTAGGG
TATTTAATTAAGAGCAATGAGGACATCAACTTTGTTAATGCTAGACTCTATGACAAAAAA
CCTTCTTTAGCTTTAGATAAGAATAAGAGACCAAGGCCAGGAGCAGATGACTCTAAAGAG
AAGAGTAATTAACAAGAAAGCGATGAGTTTTCCCCCTTAAGAGGCATAAAAGAAAGTGAT
ATTCTAATAATTTCAACTGTTGATCTAATTGCGCAGTCTAAACAGAGAGTTGATGATATT
AAGAAATTAATAACACCTGAGTGGCTAAAAATCAACCTACTTGTATCAAACTCTATGTTC
GCTTATGTCTCTTAGAGAAGTTAAAAAGGTGCTACATTTTTAGAGGTGAAGTTAGATATC
TCAAAGAGTTCTTTTCTGAGAAGAATAGAATATAAAACTCTGAGAATGAGTGAATTCTAT
GGGCTTACAGATACTATTTTAATGCCAAAAACTGCTTTATAATTGATACAAAAGAGTTGC
GAGTATCATAAGAATACCATTTAGATGTAATAGTTTGTTCAACAATTTGGAGGAAAATTT
AATCCATCATAAAGAGAGGCACTAGTAGAGGTCACAAAAATGGTAGATGACTAGCTCTTA
TTGATTCAAGGTCCACCTGGAACAGGGAAGACTCATACTATTACTGGTATAATTTCGATG
TTGATCAGATCCGGGGTTGAAAAAATTCTTGTGTGTGCCCCTTCTAACGCAGCTGTTGAT
GAAATAATTACAAGAATAAATTAAAGAGGCTTAGTTGGATTGGATTTGAAGAAAGATGAT
ATAGTTGAAATGATGGTAAGAATTGGATCGATGGATTATGAGCCCTCACCACAAGTAAAA
CCTCACACTCTAGATCAAAGACTGATCTTAACCCTTAACAGTTAGATGCTTCATGACAAC
AAAGTCAAGATAAACTATTGTGAAGAGATACTAGATTTACTTAAAAAGAATATTCAATTA
TCTGTTGAAGACAAGAATCACAAAATCTATTTGTAATCTCTAGTTGGCTAGAATCTAAAG
AAGCTTAAAGATTTTTTCAAGAAGTATCCCACAACATTTGACTAGAAAAAGTTCTTTCTA
AACATTAAGGAGCGCTTGATGGCTTAGAACTCTAAGATAAAGTAAAATATGGAAGAAAAC
AGATAGAGTTAAGGAGGTGATTGGAGATATGTAGAAAACTAAATTATCCTTAAATCTAAA
ATACTATGTTCTACCCTCTCGATGGCTGGTGTTGAAAAATTTGATATCGTAAAGGATCAA
GTAGAATTTCTCATAATAGATGAAGCATGTCAGTGCATAGAGCCCTCAACTTTAATCCCA
TTTGAGCTTGGACCTGCCAGAGTCATTCTAGTTGGTGATTAAAATTAGCTTCCTGCTACA
ACTTTCTCAGACAATAGTGAACGCACTAAATATAGCCGTAGTTTCTTTGAACGATTACTT
GATAATGGATATTAGAGGTACATGCTTTAAATACAATACAGAATGCATCCAGTTATTAGA
TAGTATCCATCTCAAACATTTTATGAAAACAGAATTACAGATGACAAGACTATCTCTACA
AGAGAGATTCCTCCGGTTATTGAAAGCATAAAAACTTACTTTACTCCATCAGTCTTTTTC
GATTTAATAAATTCATAGGAAACTTTAGCTGAGACGTCCAAATCTAATAATGAAGAAGCA
TAATTTACTCTCAATTTGATTTAACTGTTAAAAGAGATAAGCAACTAAAGTAAGTCTGCT
GCACAATAGAAAAGTAATAGCTTTGATTTTTTGAAGAACAAAATAGGAATCATCACTCCC
TATAAATCACAAGTTAAAATCCTGAAGGATTAGATTGCTCCTTGGTTGCGATCCATTGGC
TCAAGACTGCAAGATATTGAAATAAATACTGTTGATGCCTATTAGGGTAGAGAGAAAGAT
ATAATTATCTTCAACTGCGTTCGAAGTAATTCCTCAAATCAGTTAAAGAACTCGCTGGGC
TTCTTGGTTGATAAGAGGAGAATGAATGTGGCAATTACTAGAGCCAAACATTTCTTGTTT
GTAGTAGGCAACAGTAATACTCTTAATAGGGATTAGACTTGGAAAGGCCTAGTTGATTTC
TGCAAGAATTAAGTCTAAAGTTTGACAATGAAGTATTATGAAAACGTGAGCGACTACATG
AATGGTTACTATGCTTTTGACCAGAGATAAGATTATGAGCTTAATTCTTTGAAACAACAA
TTCGTCTGCCAACAATAATTAACTGCCATGCCATAGACTGCAAATGGTCAAAATCCTACT
ATAGACTATAAAGCTGAGTAGCTAAACAATCAGTAAAATACTCAAAGTGATAGTAGCGAA
GATGATGAAAAGATGGAAGATTTACCAGCAACAAGTCAATAAGCGTTGGTGAGTAGCTCT
ATTCATAGTACTCCCAGATCTATGCTCAAAAGAACAATTGATTAAAGAATACTTGATGAG
ATTAATGGCAACCTCTAGGAAAATACTATTGATGATAGCTAGGTAAACATGTCAAGTCAT
GGATATGTAGAAGCAGGCAATGGATTTCACCAAAATAAGAGACTTAATACTAATTAATGA


>Contig9372.0.1.g13(protein)
MSIQPELYRFHEQNEDDNELFREFEMQEQLLKQQKIKQIQDKMLDLKAKKQRISTDSDSE
TESEDDLTEQLKNFRNQDKISDQKKLLQSKLQGDGSGRKNLLDILNSNDDEGISPLKNQK
MRGMGGDPLSLNLGLTESEKKFDSIRKQYELSRGLEQKSKQDSVKKQKTDEQIRLEKIKS
EAKKLEFMELFGDDQDDKKEEKKEGLKLDFLQLETVSLPSQHGQPLQNKSFLTKDQQRKS
LMSHQDSLFYEQRRQNKKNIDSFIRSILNLDIIDMFKNQPFFEKIPDDFPQGHRQYLRVW
EKLFMYETYNIIVNSKRSEEKVSTQFEQQRRPQKSLSWVGYLIKSNEDINFVNARLYDKK
PSLALDKNKRPRPGADDSKEKSNQQESDEFSPLRGIKESDILIISTVDLIAQSKQRVDDI
KKLITPEWLKINLLVSNSMFAYVSQRSQKGATFLEVKLDISKSSFLRRIEYKTLRMSEFY
GLTDTILMPKTALQLIQKSCEYHKNTIQMQQFVQQFGGKFNPSQREALVEVTKMVDDQLL
LIQGPPGTGKTHTITGIISMLIRSGVEKILVCAPSNAAVDEIITRINQRGLVGLDLKKDD
IVEMMVRIGSMDYEPSPQVKPHTLDQRLILTLNSQMLHDNKVKINYCEEILDLLKKNIQL
SVEDKNHKIYLQSLVGQNLKKLKDFFKKYPTTFDQKKFFLNIKERLMAQNSKIKQNMEEN
RQSQGGDWRYVENQIILKSKILCSTLSMAGVEKFDIVKDQVEFLIIDEACQCIEPSTLIP
FELGPARVILVGDQNQLPATTFSDNSERTKYSRSFFERLLDNGYQRYMLQIQYRMHPVIR
QYPSQTFYENRITDDKTISTREIPPVIESIKTYFTPSVFFDLINSQETLAETSKSNNEEA
QFTLNLIQLLKEISNQSKSAAQQKSNSFDFLKNKIGIITPYKSQVKILKDQIAPWLRSIG
SRLQDIEINTVDAYQGREKDIIIFNCVRSNSSNQLKNSLGFLVDKRRMNVAITRAKHFLF
VVGNSNTLNRDQTWKGLVDFCKNQVQSLTMKYYENVSDYMNGYYAFDQRQDYELNSLKQQ
FVCQQQLTAMPQTANGQNPTIDYKAEQLNNQQNTQSDSSEDDEKMEDLPATSQQALVSSS
IHSTPRSMLKRTIDQRILDEINGNLQENTIDDSQVNMSSHGYVEAGNGFHQNKRLNTNQ