Identifiers and Description

Gene Model Identifier

Contig13491.0.g45

Standard Name

SECISBP2

Aliases

Contig13491_0_g45

Description

Ribosomal protein L7Ae/L30e/S12e/Gadd45 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

  • ( pfam01248 ) Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
  • ( pfam02426 ) Muconolactone delta-isomerase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003958700.00000000000040012475857291343Ribosomal protein L7Ae contain
ing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13491.0.g45(coding)
ATGAAGTAACAAGTCGGAAGTACAAACTCAGATGTAAAGAACTTCATCTATCAGAAACAG
TAATTTCCTGCATCCTTTCCACCAGTCATTTACCAAAACTAAACTTAGCAAGCCTAAGTA
AGGCCATACCCAAATGATTCACAGCATCAATTTGATAACTCACTCTAATACCAAAATGAT
CAGAAATACTAAGCCAACATTTAATCATAAGCTTTAGGGGGCGGACTATTTCCACATCAA
CAAAAACTCTATAGCTAACATTCAGTCAACACCTCTCAAAACTAAATGCCTCATTATACT
CAGTTAAAACTAGAAAATTTCCCAGCATTTAACTAACAATCCAGAAAACCTTTCTCAGAG
ACTGAAACTTGCTCTTTTAATACTTAACATTAAAATCTTGTTCAAAATTACCCCTATAAT
TTTAATGGTTAAGTATAAGTTTCGCAAGTTGGAACAAATTAATACTAATAGAGTTTTGGA
AGCTAAAACATCTCTTCAAATTTGCAATTAAACTCTCAGACATTTTACCCAAATTTCTAA
TAACAAAGATAAAACTAAATGGCACACCCCTAAAAAAGCAACTAGAAATATGCTTAGAAT
TATCAAAAAAATCCAGATTAACAGAAACATAATCATAAAAAAGTGAATAATAATCAAAGG
ATACAAAACTTGAAGTCAGAAGCACCCAACTATGAATTCGATAAAAACAAAGTTAAGAAA
TCCAATATAAACCTAGAACTCAAGGATCTTTAAGTTGATGTTTTAGCAAAAGAAATTTTT
CAGACAAGTGAAACCAAGGAATTTATGAAACAAAAGAAAATTAAGAAAAGCCAAAGAATT
TAGAATCATGCACCAAATCCTGAAAGAATTGTTCATGGAATTGAAAAGGTTTAAGTATCT
CATGAACCTATTTAAACCATAGAGTCTCAAAATAATAAATTTGATAATAACTTAGTTGCT
ACATCCTTGACAAGAAGAGATAATTTTGATAAAGAAAAAGGGTCGTTCAAATTTAGTGAG
TGGGATTTTCCATTAGATTTAACATAAATTTAAGCTTAAAGTTCAGTTAAAGAGAAATAG
TAAACTAAGCCTCAAGTTCAGCCAATGAAAAAATAAAAATAAGTTGTAGTGTAGAAAGAA
ATAAAATAAAATAACTCAACCTAACATAGTATTGTCAAGGCTTAAGATAAATAGATGTTG
GATGAAGCTCAAGTTCAAGCTAAGCAATAATCTCACTCAAGTTCAGCAAAACCAAAGCTA
GACTAAGATAAAAAGGAAGAGCTAAAATAAACTGAACAAGCTTAGAATTAAGATATTCAA
GAGGACAGTGAGTATATGAAAATGTGGAAGAGTATTCCTAAAAACAAAAGAGAAAGGCTG
ACAAAGAAATAAATTCAAAGAATTGATAAGCCTGATTTACTTGCTGAATCTCTCTCTGTT
TAAGTCGAAGAGAGAGTTAAGGATAAAAAGCTTGTGATCCCACAGAATCCTGATTCAAAT
TATGCATCAAGTGCGAATTAAAGTAAATCAAAGGCATAGTCTTCTCTTCAAAGTAACAAA
GGTAACTTGACGTTTGCTACCCCTGCTTAAGAGTCTATAAATCAATCATTCTCAATGAAT
TCTCGTCTCGATGATGTAAATGAATAGAGCGGAGTAAAAAGAAGCTATGTCTAGAAAGCT
TCCGGCTCTAATTAGTATAATCAACAACGCTCTAAATTTAATGATGCTAACTAATCAGCA
TTTGGGAAAGATAAAGTAAAGTCTAAGCCAAAGAAGATAGTAGTTGAGGAGAGAAATGAG
AACAATGAGATTGTGAGATAGATTATCGAGAAAGCAAAGAAGAGAAAGATTACTGCACTC
AAGAAAGCAATTTTGAGAAAGAGAGAACTTAAGGATTTTAGAGATAAAGATAAGATCAAA
ATTGAGAAGAAGGCTAAGAGGTAGCAATAATTAGAGAAAGAAAACAATGAGGGAGAATTA
TCAAGTGGGTATGTTACTATTGATGAAAATGCAGTAGAAGAAATTGGGAATAAGCAGGTT
GTTCAAGAGGGCATTAAAACTAGAGGATTTCCATATTTGCCATTGTTTAAGGATCTGGAC
TAATTTGGAGAATAAATTGAGAATGATCTTTGCAGAAAGTTTTAACCTGAGAAATCAATA
TATGCAGACCAAGAGATAAAATTCAAGGTTTTCAATAGTTAAGTGACTTAAGAATAGTTT
TACCAACTTCACCCAAAGAAAAGTATCCGAGAGTATGTGGATGTCATTTAGAGTGATGAA
CTAGACACTTGCTTGACTACTTTGATATAAAAACTAAAAAAGCTTTACTTTAACAGAAAA
TCTAATCCCAACAAGAAAGGTAAAGTGACTAGAAATGTGAAAAAGAGATACATAGTAGGC
ATCAAGGAAATCATGAAGCATTTAGCAGCTGAAAATTTGAAGATGGTTATTTTGGCAATC
AACTTAGAGAGAGTGGACGGGGAACATGGTCTTGACGATTTCATCTATCAAATCATTCAG
AAAAGTAGAGAACTCAAAGTTCCACTGATATTTGCAATGACTCGTTACAAACTAGGCTTT
GTCTCGAAATTCCAAGGTTAAATGGCTTCAGCTATAGGAATTTTCAATTTCTAAGGAGCA
AACGAGGAGTTCAATTAGCTTGTGTTAAAGAGTAAAGTAATGAGACATGATTTTTACAAG
CAGCTTGCTAGAAACGTACAAGATTATGAAGCAATACTTTTGAGAAAAGAGAATAGATTC
TTGGACTGGACATACTTTGATCAAGTGAAGAATGAAAAAACTACATTCTTTGATTGA


>Contig13491.0.g45(protein)
MKQQVGSTNSDVKNFIYQKQQFPASFPPVIYQNQTQQAQVRPYPNDSQHQFDNSLQYQND
QKYQANIQSQALGGGLFPHQQKLYSQHSVNTSQNQMPHYTQLKLENFPAFNQQSRKPFSE
TETCSFNTQHQNLVQNYPYNFNGQVQVSQVGTNQYQQSFGSQNISSNLQLNSQTFYPNFQ
QQRQNQMAHPQKSNQKYAQNYQKNPDQQKHNHKKVNNNQRIQNLKSEAPNYEFDKNKVKK
SNINLELKDLQVDVLAKEIFQTSETKEFMKQKKIKKSQRIQNHAPNPERIVHGIEKVQVS
HEPIQTIESQNNKFDNNLVATSLTRRDNFDKEKGSFKFSEWDFPLDLTQIQAQSSVKEKQ
QTKPQVQPMKKQKQVVVQKEIKQNNSTQHSIVKAQDKQMLDEAQVQAKQQSHSSSAKPKL
DQDKKEELKQTEQAQNQDIQEDSEYMKMWKSIPKNKRERLTKKQIQRIDKPDLLAESLSV
QVEERVKDKKLVIPQNPDSNYASSANQSKSKAQSSLQSNKGNLTFATPAQESINQSFSMN
SRLDDVNEQSGVKRSYVQKASGSNQYNQQRSKFNDANQSAFGKDKVKSKPKKIVVEERNE
NNEIVRQIIEKAKKRKITALKKAILRKRELKDFRDKDKIKIEKKAKRQQQLEKENNEGEL
SSGYVTIDENAVEEIGNKQVVQEGIKTRGFPYLPLFKDLDQFGEQIENDLCRKFQPEKSI
YADQEIKFKVFNSQVTQEQFYQLHPKKSIREYVDVIQSDELDTCLTTLIQKLKKLYFNRK
SNPNKKGKVTRNVKKRYIVGIKEIMKHLAAENLKMVILAINLERVDGEHGLDDFIYQIIQ
KSRELKVPLIFAMTRYKLGFVSKFQGQMASAIGIFNFQGANEEFNQLVLKSKVMRHDFYK
QLARNVQDYEAILLRKENRFLDWTYFDQVKNEKTTFFD