Identifiers and Description

Gene Model Identifier

Contig9491.0.g15

Standard Name

SC35

Aliases

Contig9491_0_g15

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGR159C0.00000000019994075865167896NSR1 SGDID:S000003391, Chr VII
from 807656-806412, Geno...
T. thermophilaTTHERM_008578800.00000030014504373857585polyadenylate-binding protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9491.0.g15(coding)
ATGCACACCTAACCTTACATGAAACCTAGCTTCTCGTAACAAACTTTCGACTCTTAAAAA
GACTAGAATAAATTTAATTAAATGGATTCCACTACTAATATAGGAGGGAAAACTTTTGAA
CAGCCTGCTCCCTAGAGATTAACTACCTATCAAAAATACTTGCAGTAAAATAGTGGTGGG
ACAAGCTCCTCTTCTTTTTCTTATAATTAAAAAAGTTCAAATGTTTCTCTGGGGTCTGCT
GCGGATAGAGCAGGAACTTCCTCCCCCAATTTCAAGAAGCTATTTATACATAACATAGAC
TTCAGGGTCTCAAACCAAGATTTGTTCAATCTGTTCTCAGAGTATGGCAAGATCTATTGT
CTAGAAGTGCCTAGAAACGCCATGCAGCAACATAGAGGACTTGGCTTTGTGGAATATGAT
AAACATGAGGATGCAAGGAGAGCCCTTGAAGGAGCGAGTGGCAGATATTTACATCAGAGA
GAGCTTAGATTGGATATTTTCAGAGAGAAGCATGAAATGGATAAGAAAAAGTAATTTGTG
AGGTCTAGATCGAGATCTCCCATAACTCACTAAAGAATCGTTAATGGACAAGGCAATAGT
AATTCTAATTTTTAGAGCAATTTTCATGGTGGATATCAGAAAGAAGGAAATAATGCGTTT
TTTAATAAGAGACCAAGGACTGATTTCGGCAAAACTTATTACATCAATAGGGACTAGTAG
CTTAAAAGTGGAGCAGAGTAAATTAATAAAATTCATGATAGAAATTAAAGTTAAAATGAA
ACTGAAAAGAGAAATCCAGATCATTTATAAAAGCCCGAATAAAAAGAGAATAAATAGAGC
TAGTAGGAGTAAAATCCTCCTTAACAACCTAAATAGAAAACTTATTAGCAACCAATTGCA
AACTAAAATTCTCAACAAAAACGTCAAGATGAAGAAAACGAATAAGACACAGATGTGGAT
GCAAACTCTCCACTTCCAGAGGAAGAGCAAAGTAGGGGAAGAAAGTAAAAGAAAGACAAG
GAAGATGGAGAAATTATGAATGACTCTGAAATTCAGCAGACATTTAGTAAATCAGATCAA
AGCCCATAGAAGAGTAGCTGCAAAGTAGTTGATGATAAATTAATGAATCAGAACTAGCCT
TAGACTGATGATTCATTTGCAGAGCCAGCTCAAGATGAGAGTAAAGGGTCAGTTCAAAAG
CCTTATGAATAAATACCCAACAACAACATAGGCGAATTCTCTTCTTCAAAATCTAGGAGT
TTGAAGTCTATGTCAGAGCTGTCAGCTATTATAGATACCAACAATTCTTCTAAAGTGTTG
AGAGATAACAGTGATATTTACCGAAGATAATTTGAGGTAATTCAGAAGCATAACTAGATG
AGCGAGAGAGAACGAGAACTGGAGCTTTAAAATTATGAGAGAGAAATGAACTAGCCAAGA
GATAATTTTGCTGAGGACAATTTTGATAAGATACAATCTCTGACAAGATCTAGAAAGTCC
TTATACGCAGAGGATTATGATTCTAAATAATATCATTCTAGAGATTATAAACATGATTAG
AGTAGAAGGAGAAGTGAATCTGATGCTAAATTTACTTCAAAACATCATGATTAAAAAGAG
AAGAGATTTAATGAAGAAAATTCAGACTCAGAACCTCGAAAAGATCGATTTTCAAGAGAT
CAAATCAATTTTAGAGATGAAATTAGGCTACAAAAAAGGAGTAGAGAAAGAGATTTTAGC
AATGAATTTGATGTAATTTAAAAGAGGAGAGCGTCACCAAATGAGAGATTTAGAGAAATG
AGAAAAAATGCCCGAGAGCTATACGGAAGCAAGAATGATTCAGATTTTAAAAGATAGTCT
TTAACTCCCAATAAAGCATTAGTTTTAAGAGAGTATGAAAGGATCCCAATGAGAAATACA
TATAACGGTGTATCAGATAAAGTAATTGAACACAGAATCTATGAGATATCTAGAGAGGCA
AGACTGGACTAGTTTCCTGATAAGGACTGGTCATTTTACAAAAAAGAACATATGAGAAAT
AGACCTAAGCCTAATCCTAATCGAACTAGTTACTTAGATTTATGGAATGAGAAAGAACTT
GGGATACCATTAGGTGAAAAAGTTAATATTGAAAATCATTTTATAAGAGATTATGAAGTA
GCACCGAAATAAACAAAGAAAATAAGTTAAACCAGAAGATTTTAAGAAGATGATTAATAT
GATAGAGATGAAAGCAGACCCAGCAATTAAGCTGGAGTTTAGCACTATAAAGGGTATGGT
TAAGGTTACCATTAATCAAGAAATTTTCCAGGTGCTCCATTTTAAGCTAATTTAAGAGAT
GAACTTAATCAACCTCCTAGAGATAAAGCGATAAAATATGAAAATCTTTAAACTCGAGAT
CACTTTCGTGATAAACCTAGATTCAAAGATTATTCTGATCGAGACTATGATAAATACACT
CAAAGTCATCTAAGAAGAGATTTTTAATATGATAAAAGACACATCAAGCAAACTTATGCT
GACGATGATATAGATCGTGACATTCATAAAAGGTATAATTAATTTGACATTATCCCCTAA
CTTTATTATTCATAGAGATCCAAATTCGATATAAACTTACAATCAGAGAAATTTTTCAAA
AGACAATGA


>Contig9491.0.g15(protein)
MHTQPYMKPSFSQQTFDSQKDQNKFNQMDSTTNIGGKTFEQPAPQRLTTYQKYLQQNSGG
TSSSSFSYNQKSSNVSLGSAADRAGTSSPNFKKLFIHNIDFRVSNQDLFNLFSEYGKIYC
LEVPRNAMQQHRGLGFVEYDKHEDARRALEGASGRYLHQRELRLDIFREKHEMDKKKQFV
RSRSRSPITHQRIVNGQGNSNSNFQSNFHGGYQKEGNNAFFNKRPRTDFGKTYYINRDQQ
LKSGAEQINKIHDRNQSQNETEKRNPDHLQKPEQKENKQSQQEQNPPQQPKQKTYQQPIA
NQNSQQKRQDEENEQDTDVDANSPLPEEEQSRGRKQKKDKEDGEIMNDSEIQQTFSKSDQ
SPQKSSCKVVDDKLMNQNQPQTDDSFAEPAQDESKGSVQKPYEQIPNNNIGEFSSSKSRS
LKSMSELSAIIDTNNSSKVLRDNSDIYRRQFEVIQKHNQMSERERELELQNYEREMNQPR
DNFAEDNFDKIQSLTRSRKSLYAEDYDSKQYHSRDYKHDQSRRRSESDAKFTSKHHDQKE
KRFNEENSDSEPRKDRFSRDQINFRDEIRLQKRSRERDFSNEFDVIQKRRASPNERFREM
RKNARELYGSKNDSDFKRQSLTPNKALVLREYERIPMRNTYNGVSDKVIEHRIYEISREA
RLDQFPDKDWSFYKKEHMRNRPKPNPNRTSYLDLWNEKELGIPLGEKVNIENHFIRDYEV
APKQTKKISQTRRFQEDDQYDRDESRPSNQAGVQHYKGYGQGYHQSRNFPGAPFQANLRD
ELNQPPRDKAIKYENLQTRDHFRDKPRFKDYSDRDYDKYTQSHLRRDFQYDKRHIKQTYA
DDDIDRDIHKRYNQFDIIPQLYYSQRSKFDINLQSEKFFKRQ