Identifiers and Description

Gene Model Identifier

Contig21404.0.g97

Standard Name

SBDS

Aliases

Contig21404_0_g97

Description

Shwachman-Bodian-Diamond syndrome (SBDS) protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

  • ( pfam01172 ) Shwachman-Bodian-Diamond syndrome (SBDS) protein
  • ( pfam09377 ) SBDS protein C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001487609.000941515806455e-45conserved hypothetical protein
SGDYLR022C4.0017993270483566e-44SDO1 SGDID:S000004012, Chr XII
from 184926-184174, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21404.0.g97(coding)
ATGATAAAGACGCCAGTCAATTAAATTCGCCTGACCAATGTGGCTGTCATCAGACTCAAG
AAGGGTGGCAAGAAATTTGAAATTGCCTGCTATAAGAACAAGGCAGTCAACTGGAGAAAC
AAATAAGAATCCAACCTCAGTGAAGTACTGTAGATTGATCAAATATTCACAAATGTGTCA
AAGGGAGAAGTAGCAAAGCAAAAGGATTTGCAGGCAGTATTTGGGAAGATGACTCAAGAC
GAGATAGTCATTGAGATATTAAACAAGGGAGAACTCCAAGTGAGTGAGCTAGAGAGAGAC
GAGCATCTGGATAGTTTAAAGAAGGAAATCGCTAATATAATTGCACAGAAATGTGTCAAT
ACTTCTGATGGCAAGCAGTTTCCTGTCAGTATTATCATGAAAGCAATGAATGAAGCAAAT
GTGAAGATAAACCCAAAGGATAACGCCAAGAAATAAGCTTTGACCTTCATTCCTGACTTA
AAGAACGTAATTCCCATTGACCGTGCAAAGATGCGATTGAAGATATCGTTTGAAAGATAA
GATTAATTGGAAAGACTTAAAGAAGTAATTGAGAGAGACTACGCACAGGACTATGAAGTT
GAGAGAATCGGAGAGAAATTCATGCAATGCCAGATTCAACCTAACATGTTCAGAGAACTG
AATAACATAGTGAAGGATGACAAGTAGTTTTATAGTGGAGTAACAATAGAAATCCAAGAA
CAGCAGGTGATGCAAGAAACTGGAGAGTTAGATGAATAGATGAATCACTTGGGTATTACT
AGCAATAACGAGGAGATCAAGCAGTAACCAGCTAAAGTGGTTGTGTAGGATCAAGAGGAG
ACTAAATCATAGGCACAAGCTGCAAATACATAATCATAGAAGGATCAAGCGAGTAGAAGC
TAGTTGAAACAGTAGAAAAAGCAGGAGAAAATGGAGAGATAAACACAACAGCAGTAGATA
GATGATCAAGATGATAACTTCAGTGATGATAATAAGAAGAAAGGCAAGAAGAGTAAGGGA
GGAAAGAAGAAGTGA


>Contig21404.0.g97(protein)
MIKTPVNQIRLTNVAVIRLKKGGKKFEIACYKNKAVNWRNKQESNLSEVLQIDQIFTNVS
KGEVAKQKDLQAVFGKMTQDEIVIEILNKGELQVSELERDEHLDSLKKEIANIIAQKCVN
TSDGKQFPVSIIMKAMNEANVKINPKDNAKKQALTFIPDLKNVIPIDRAKMRLKISFERQ
DQLERLKEVIERDYAQDYEVERIGEKFMQCQIQPNMFRELNNIVKDDKQFYSGVTIEIQE
QQVMQETGELDEQMNHLGITSNNEEIKQQPAKVVVQDQEETKSQAQAANTQSQKDQASRS
QLKQQKKQEKMERQTQQQQIDDQDDNFSDDNKKKGKKSKGGKKK