Identifiers and Description

Gene Model Identifier

Contig18361.0.g86

Standard Name

SART1

Aliases

Contig18361_0_g86

Description

SART-1 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006269900.0000000000005000841553255702hypothetical protein
SGDYOR308C0.0004999512321494991SNU66 SGDID:S000005835, Chr XV
from 896387-894624, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18361.0.g86(coding)
ATGGTTATGAAGGACACCTCGGTCATTATTGACAACGAAGACTACGAGGGAGATGTTTTG
GAAAATGTAGATCTGTAGAGCAATTTCAGACAGAGAATGAAACTCAAAAAGTAGTAAGAG
GCTAAAACAGGCATACCATCAAATGGCTTTCAATCCAAGAATATTCTGCCACAGTATGAT
GAAGAAGATGAAGATATTACTGCCAAAAAGCAAAACAGAATTCTGCTATAGTCTACTGAC
AACGATGGTGTTTCAGGTATGACTAAAGAGCAGCGATTGGAGGAACTTAGAGAAAAGTTA
AGCAATAAGTACAAACAAAAGGTGTCTCTTGATGTAACCAAGAACATAGGGTCTGATTAT
GCCACAGTGATTTCACCCGATGATCACTCAAATGAGAGCTATTAATCAACTGCAGTTGGA
AATGGACAGATTTTAGGAGGATTTAAAAAGTTTGCGAAACCAAGCATACTTAAGAAGAGA
TAGGCCGAATAGGATATAGTCACATTACTAGAGTAAGAGAGTGATTAAAGACAGGGTGGT
TAGCAAATTGAAAGTGGACTTGGAACTAGAGAGCAAAAGCAGAGAGAGCTTGAATCAGAT
AGAAAATTATAGGAACAGGCAGAAGAGACAAAGCTTAGGAATTTCTAAAACGCCACTACT
ATGAACAAAAGAGTCAAGTATGATTAGAGAGATGAATTTGAAGATGATGAGTACTCTTAA
ATTCAAAATCAACTTGAAAAGCAAAGAATGAAACAGTAGAAAGATAAGTAGCAGCACAAA
GGTGAAGATTTTATCTAAAACCTGATTCAGAAGCAATAGCAGTCGACTGCAAACTAAGAT
TAGTAAATGACAGATATTTCCCAGGTTTAAGATGAAGAGGTAGAGCTTATCACAAGCAAA
CCTGAATTGAGAGGAGATAATGTGCAGGATATCACTAGTATTTCAAAAGATATCCCAGTC
AACAATATTCCAACTCAAGATTAACTGAGATAAAATGGCATGTAGTCTTAACTGAATAAT
GGAGCTATGACTATGGGAATTCAATCTCTATCTCTAGCAAAAACTGGATTTACAAGTGTT
GTTAATGTTACTTTGCCTTCACAAAGAATCTAGGAGCTTGCCAGACTGAATTAACAACGT
AACCCTTATGAAAAGGCAGCTGAGGAAGAAGAGAAAACTAAATCTTTGGAAGGTTAATCT
TTAACCGAGAAAGAAGAAATCAAGGATGAGATTATTCAATAGCTCGAGGAAAGATTGTGT
GGCAAGGGCTTAGGAAATGCTCTTCAAATATTCAGAGATAGAGGCATGTTGGGCAAGAAC
TTCTTCTTTGGAAGAAACAAAGATCAAAACACAGAGTAAATCTTGAAGTCATTTGGTAAA
GATGGCAGTCAAGAAGATGATCGTGTTCGTTTGGTTCATGTTGATAAGAGAGGCAGAGCT
TTGACATAGAAAGAAGCATTCAGATAAATGTGCTGGAAGTTTCATGGAAAGATGCCCAGT
CACAAGAAGCAAGAAAAGAGAAAAAACAAGGAAGATCTTGAAAGCAAGATTAATTCAATC
AGTATTGGTCTTAATCCCCAAGCTAAAGTACCAAGTGCAGCAAAAAAATTAGGAAATCTT
GGTAATCTGGGAAGTTTAGGAGCAAAGAAAAAACCAAAGAAAATTTGA


>Contig18361.0.g86(protein)
MVMKDTSVIIDNEDYEGDVLENVDLQSNFRQRMKLKKQQEAKTGIPSNGFQSKNILPQYD
EEDEDITAKKQNRILLQSTDNDGVSGMTKEQRLEELREKLSNKYKQKVSLDVTKNIGSDY
ATVISPDDHSNESYQSTAVGNGQILGGFKKFAKPSILKKRQAEQDIVTLLEQESDQRQGG
QQIESGLGTREQKQRELESDRKLQEQAEETKLRNFQNATTMNKRVKYDQRDEFEDDEYSQ
IQNQLEKQRMKQQKDKQQHKGEDFIQNLIQKQQQSTANQDQQMTDISQVQDEEVELITSK
PELRGDNVQDITSISKDIPVNNIPTQDQLRQNGMQSQLNNGAMTMGIQSLSLAKTGFTSV
VNVTLPSQRIQELARLNQQRNPYEKAAEEEEKTKSLEGQSLTEKEEIKDEIIQQLEERLC
GKGLGNALQIFRDRGMLGKNFFFGRNKDQNTEQILKSFGKDGSQEDDRVRLVHVDKRGRA
LTQKEAFRQMCWKFHGKMPSHKKQEKRKNKEDLESKINSISIGLNPQAKVPSAAKKLGNL
GNLGSLGAKKKPKKI