Identifiers and Description

Gene Model Identifier

Contig14403.0.g66

Standard Name

SARS2

Aliases

Contig14403_0_g66

Description

tRNA synthetase class II core domain (G, H, P, S and T)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00587 ) tRNA synthetase class II core domain (G, H, P, S and T)
  • ( pfam00293 ) NUDIX domain
  • ( pfam07855 ) Protein of unknown function (DUF1649)
  • ( pfam02403 ) Seryl-tRNA synthetase N-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYHR011W2.0007889996237956e-71DIA4 SGDID:S000001053, Chr VII
I from 127780-129120, Gen...
T. thermophilaTTHERM_001143603.999543040313994e-55seryl-tRNA synthetase family p
rotein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14403.0.g66(coding)
ATGACTAAGCTGTCACATGTTCGCTTAAATTTCAAAGATTTCAATCAAAAGTTACCTTTA
ATCAAACAAAATGTCATTAATAGAAATGCTTAAAAATATGCAAACGCAGACTTAGTGAAT
CATTTATATGAGGAATATAGAAAGAAAAGATACGAAATAGATATGCTTAGAAAAAGAAGA
AATGAACATTCTTCAGCATTGAAAGCAATTTTAGTGATGGGAGATGAAGAGAAGAAAGAA
AAACTTATGGAATCTCATCATAAAATAGGGAAATCATTTAAAACTGATTTGCAAAACTAT
GAGAAAGACCTAGACAATATTGAGCTTTAACTTATTACCGAGGCATTGAAACTACCAAAT
AAAACTCATCCAGATAGTCCAGTAGGAACCGAACTCAACAATAAAGTTATCAGATAAAAC
AGTGAAAAATATAAAGGGCTACATAAAAAGTCCCATTTAGAAATTGGAGAATAATTTGAT
CTGTTTGATTTCCAAAATGCATCAAAACTGACAGGAAATAAATTCGTGTTTCTTAAGAAT
GAAGCTGCTATCTTAGAATTAGCGTTGATAAATTATGCAATTAATAAAGTAGGGAAGAAA
GGATTCACCCCTGTAACAACTCCTGATTTTGCTAGAGCTCATGTTGTAGAAGCTTGTGGA
TTTTAGCCAAGAGATGAAGCTGGATAAATATACATGCTTGACAATATGAATGAGTGCTTA
ATTGCAACTAGTGAAATTCCAATGGCTGGTATGCATATGGGTGAATTAGTAAAAAAAGAC
TCATTGCCAGTCAAGTATGTATCATTCAGTCACTGTTTCCGAAAAGAAGCTGGAAGAGGC
GAAAGTTCCAAAGGTTTATATAGACTTCATTAATTTTCAAAAGTTGAGATGTTTGGATTA
TCAGAAGGAGATTATTAAAAGAGTGAAGATCTCTTGAATGAGTTTGTTTCAATATAAGAA
GAAATAGTAGAATCTTTAGGTCTCCATTATAGACTGTTAGATATGGCTACAGAGGAACTT
GGAGCAGCTGCCTATCGTAAATATGATATTGAAGCCTGGATGCCTTCTAAACAAGACTAT
GGAGAAATTTGCTCTGCTTCAAATTGCACTGGTTATCAATCAAAGAGATTAAACATTTCC
TATTTTGATCAAGGAGCTGAGAAGAAGCTAGTGCATACTGTTAATGCAACAGCTCTAGCT
GTGCCTAGAATCATTATGTCAATTCTTGAAAACTATTGGGATGAGAACACATAAACAATG
AGATGTGGGGATCAATTGACAGAGAAAGCGATTGATTCAAAGATTGAGCAAATGTTGGAG
AATATAACTAAACACAAGGAAGACGAAGTGACTCTAACTTTCTTTAATCAATAATAAGGA
TAGTCTGGAGTGAGTTATTTTAGTAATACTTCATCAAGAAGAGAGCCATGGGAAATATGG
ACAGTACAGTTTAAATTCACAGACATAAGTGATGCTCAAGTAAATCTTCAAGAAGAGGAA
GAGAAATTCAATACACTAATAATGGATATTGTGGACAAGATAAACGACAGTTGTGACTTG
CTGCCAAATGTTTATGAGGGACTTAAGTGCTATCCGTTTTAAGTTGAAATCAAGAAGATG
CAATCAGGATCAGCATAGAATGCAGGATCTTCATTCTTCGGATTATTCAAGAAAATTGTA
ATATTAATTTTAACATAATAAAAAATGGAATTCGACTCTGAAAAACTTAAAGATACAGTT
GATTAACATGGAAGACCAGTATTAGTTCCTTCTGTTACTGTAGATGCTATGGCAGTAAAA
CCAAAGTAAGATGGGTCTGGCCACGAAATTCTAATGATAATTAGAGGTGGCAACCCTTAC
AAAGGTCATTTAGCCTTCCCAGGCGGTTTCGTAGATTATAACGAGGACCCACTCGTAGCT
TGTGTGAGAGAACTTCAAGAAGAATGTGGAATAGAAGGCACAAATCCCACTTTAGTAACA
GTTGCCGGCAAGCCTGGAAGAGATCCCAGAAAGCATATTGTATCTATTTTCTACAAAGTT
GATGTCGATCCAACTGCTCAAGTCAAGGCTGGAGATGATGCGGCTCACGCTCAATTCTAT
GACATTGCAGAGATTTGGGGCAAGAGATCAGAATTAGCTTTTGATCATGGAGATAACTTG
AAATTATTGTTGGAAAAATATTATCCCTAATATCTTTGA


>Contig14403.0.g66(protein)
MTKLSHVRLNFKDFNQKLPLIKQNVINRNAQKYANADLVNHLYEEYRKKRYEIDMLRKRR
NEHSSALKAILVMGDEEKKEKLMESHHKIGKSFKTDLQNYEKDLDNIELQLITEALKLPN
KTHPDSPVGTELNNKVIRQNSEKYKGLHKKSHLEIGEQFDLFDFQNASKLTGNKFVFLKN
EAAILELALINYAINKVGKKGFTPVTTPDFARAHVVEACGFQPRDEAGQIYMLDNMNECL
IATSEIPMAGMHMGELVKKDSLPVKYVSFSHCFRKEAGRGESSKGLYRLHQFSKVEMFGL
SEGDYQKSEDLLNEFVSIQEEIVESLGLHYRLLDMATEELGAAAYRKYDIEAWMPSKQDY
GEICSASNCTGYQSKRLNISYFDQGAEKKLVHTVNATALAVPRIIMSILENYWDENTQTM
RCGDQLTEKAIDSKIEQMLENITKHKEDEVTLTFFNQQQGQSGVSYFSNTSSRREPWEIW
TVQFKFTDISDAQVNLQEEEEKFNTLIMDIVDKINDSCDLLPNVYEGLKCYPFQVEIKKM
QSGSAQNAGSSFFGLFKKIVILILTQQKMEFDSEKLKDTVDQHGRPVLVPSVTVDAMAVK
PKQDGSGHEILMIIRGGNPYKGHLAFPGGFVDYNEDPLVACVRELQEECGIEGTNPTLVT
VAGKPGRDPRKHIVSIFYKVDVDPTAQVKAGDDAAHAQFYDIAEIWGKRSELAFDHGDNL
KLLLEKYYPQYL