Identifiers and Description

Gene Model Identifier

Contig1296.0.g12

Standard Name

SARS

Aliases

Contig1296_0_g12

Description

tRNA synthetase class II core domain (G, H, P, S and T)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00587 ) tRNA synthetase class II core domain (G, H, P, S and T)
  • ( pfam02403 ) Seryl-tRNA synthetase N-terminal domain
  • ( pfam01763 ) Herpesvirus UL6 like

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001143601.000444791949842e-158seryl-tRNA synthetase family p
rotein
SGDYDR023W2.000893364583308e-148SES1 SGDID:S000002430, Chr IV
from 489508-490896, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1296.0.g12(coding)
ATGCCAATCGACATTAATTTACTCAGAGAAGACGCTGGTAACGATCCAAACGTTGTAAGA
AAGTCAGAGGAGCAAAGATTCAGAGATCCAGTTCTTGTTGATCAAATCATTGAAATCGAT
GTGCAATGGAGAAAATTGACTTTCGACTTGAACAAGCTCAAGAAGGAACATAACGATTTT
TCAAAGGAAATCGGAAAGAGAATCAAGGAATCAAAGGGTCAGGACAAGTGCGAGGAAGAG
AAAGCCCAATCAAACCTGATGAAAGAAAATGTAGAAAAAGTAGAGAAGGAACTAGCAGAG
TGTTCACTTTTAAGAACATAAAAACTAAATTTGATTGGAAACATTGTTCATACAGATGTG
CCTGTTTCAAAAGATGAAAATTTGAATCAAGTCACATCTGAATGGGGATAGATACCTGAT
TTAAAAGTAGATGGCAAAACACTTGGACATCTTCATCATCACGAAATCATGCAGTGCCTT
GATATGGTTGAATTCGAAAGAGGTCAAAAAATCGCTGGACACAGAGGCTATTTCTTGAAA
GGCAATGGTGTTCTATTGAACTAAGCCCTCATCAACTACGGTGTCTCATTCTTGTCAGCT
CAAGAATACACTCCACTTCAACCACCCTTCTTCATGAAGCAATCAATCATGCAAGAGACC
TGCCAACTCTCAGACTTTGAAGAGAATTTGTACAAGGTGCATGGTCAGTCAGTTGACGAG
CCAATGTACTTGGTTGCCACTTCAGAACAACCAATTTCAGCTCTTCACAGAAATGAATGG
ATTGAACCACAAGATCTCCCAATCAGATACGCTGGTATCTCATCATGCTTCAGAAAGGAA
GCTGGTGCTCATGGTAGAGACGTGTGGGGTATCTTCAGAGTCCATCAATTCGAGAAGGTT
GAGTAATTCTGTATTACCACTCCAGAGAAATCATGGGAGATGCACGAGGAGATGATTAGA
ATCGCAGAGACTTTCTATAAAAATCTTGAACTTCCATACAGAGTAGTGAATATCGTCTCA
GGTGAGCTCAATGATGCTGCTGCCAAGAAGTACGATCTTGAGGCTTGGTTCCCAGGTTAC
GAAGCCTACAGAGAGCTCGTATCAAGCTCAAACTGCACAGACTATCAGTCAAGAGGACTT
GAGGTTAGATTGGCTCTTAAGAACAACACAAATAAAGTGTACGTCCATATGCTCAATGCC
ACTCTTTGTGCTACTGAGAGAACCATGTGCTGCATTCTTGAGAACTACCAGACTCCAGAG
GGAGTTAGAGTTCCAGCAGTTCTTCAACCATTCATGGGAGGCAAAGAGTTCATGCCATAC
AACAAAAAGGCTGTCGAGCTTTTCCTTGAAAGAAAAACAAAGGAAGAGGCCAAGGAAGCC
GGAAAGAAGAAGAAGTGA


>Contig1296.0.g12(protein)
MPIDINLLREDAGNDPNVVRKSEEQRFRDPVLVDQIIEIDVQWRKLTFDLNKLKKEHNDF
SKEIGKRIKESKGQDKCEEEKAQSNLMKENVEKVEKELAECSLLRTQKLNLIGNIVHTDV
PVSKDENLNQVTSEWGQIPDLKVDGKTLGHLHHHEIMQCLDMVEFERGQKIAGHRGYFLK
GNGVLLNQALINYGVSFLSAQEYTPLQPPFFMKQSIMQETCQLSDFEENLYKVHGQSVDE
PMYLVATSEQPISALHRNEWIEPQDLPIRYAGISSCFRKEAGAHGRDVWGIFRVHQFEKV
EQFCITTPEKSWEMHEEMIRIAETFYKNLELPYRVVNIVSGELNDAAAKKYDLEAWFPGY
EAYRELVSSSNCTDYQSRGLEVRLALKNNTNKVYVHMLNATLCATERTMCCILENYQTPE
GVRVPAVLQPFMGGKEFMPYNKKAVELFLERKTKEEAKEAGKKKK