Identifiers and Description

Gene Model Identifier

Contig13143.0.g63

Standard Name

SAP18a

Aliases

Contig13143_0_g63

Description

Sin3 associated polypeptide p18 (SAP18)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam06487 ) Sin3 associated polypeptide p18 (SAP18)
  • ( pfam08731 ) Transcription factor AFT

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13143.0.g63(coding)
ATGAGAAGAGGCGGTGGCGAATAACATAGTTCAAGATATACAAAGCCAAGAGAAGACCAT
AATAAACCTGATACAACTAGCAAATAGAATTATAGCAATTAGCATTAGTATTAGTAGCAG
CATGTGGACAGAGAAAAAACTTGCCCATTTTTATTGAGGATATTTGTGAAAGAAAATCAG
ATACATAAATTAGATGAATTTGATATCGATGGGACAGTGCCTGAAAAAGATGAGATTTAG
ATATACACATGGATGGATGCTACACTTGGTGAACTTGCAGAGACAGTCAGACGTGAGGTT
GAAAGTGCTCGTAAAAACGATCCAGAAATAGTATTCGCTTTTGTCTACCCTGACAACCAA
GGTAAATTTAGAAGAAAAGAAGTTGGAGTGGTCATGAGGGGATAAAGATCTATGGATTAC
AAGTGGACACTACAGCAACTCAGGTTTGTCATAGGGGATTACATCGACTTGACTCTGAAA
TACTCTGAGGGTGGACATAATAATAGGAGTGATCGCGCTTATACACAATATGGCCAGAGT
TAAAGATAAAACAATCAGACTTTACAATCTACAGTAGCTCCAAGAGAAGCGAGCACTGCC
CTAGAAGAATCTAAATCTCAAATTCACAACTCAGATCGTAGAGACTCAAGAGTTAAAGAT
GATTTCAGAAAGCCAAAAGAACTAATAATTGAGAGACACGATTCAAGAAGGACGAACGAA
GGTGCTGAAAATGAGAGAAGAAGGGAAAGACCTGGTGACAATTCTAGGAGAGAACCAGAG
GTAGCAGCTACTCGTAGATCAAGATCAAATCGTAGGGATGACAGGGATGTTAATAACAAT
AGAAGAAATGACAGAGGCCATGATAATAGAAGCAGGTACGAAAATAACAGAAGAGATAAT
TTCAGAAGATGA


>Contig13143.0.g63(protein)
MRRGGGEQHSSRYTKPREDHNKPDTTSKQNYSNQHQYQQQHVDREKTCPFLLRIFVKENQ
IHKLDEFDIDGTVPEKDEIQIYTWMDATLGELAETVRREVESARKNDPEIVFAFVYPDNQ
GKFRRKEVGVVMRGQRSMDYKWTLQQLRFVIGDYIDLTLKYSEGGHNNRSDRAYTQYGQS
QRQNNQTLQSTVAPREASTALEESKSQIHNSDRRDSRVKDDFRKPKELIIERHDSRRTNE
GAENERRRERPGDNSRREPEVAATRRSRSNRRDDRDVNNNRRNDRGHDNRSRYENNRRDN
FRR