Identifiers and Description

Gene Model Identifier

Contig9.0.g67

Standard Name

SAML1

Aliases

Contig9_0_g67

Description

Phage integrase, N-terminal SAM-like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam02899 ) Phage integrase, N-terminal SAM-like domain
  • ( pfam02895 ) Signal transducing histidine kinase, homodimeric domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9.0.g67(coding)
ATGAAAGAGGCTTTTACTCATGAAGCACAAATGAAGGAGCTCAATTAAAGAAAAGAATTA
GACGAATTTAAAAGCCAAGTATATTATGAATTGGAGCAGGCAACAGACTTCTTGATGATC
AAGGATTTATATAAGAAAGGCTACACTAAAATAGAAGAATGGATCAGCAAAATTAATTCA
GACATTATTAATATCTCAAAATAGCACACTAATCAAACATCCAACGAGCTTCAGGGTTAA
TATGACAATAAAATTGATATTATTAATAAGGAATTTTTGATTTTGAAGACACAAATTGAA
TTAATGAAGGATATGAGGTATTAAATATCATAAGTCAGTTAAAAGTTGGATGAAAAGGCC
ACTTATTAAAATCTCAGAAATTTGGAGTACTAAATGAATGATTATGTGAAGATTTAGACG
CTGAAAGTAGTAGAGTAAGACATTAAAGAAAAAGTGGACTAAGAAGTATTCAACAGTTTG
AAGGATGAATTTAGATTAGCATAGGGCAATATTCAAATGCTAATGAAGATAAACAAGGTA
CATGAAGAGACTTAGCATCAGATGGATCACTCTCTAAAGGATAGTTTGCATTAATTAGAG
AAGAAACTAACCAACGTAGAATATGACTTTAAAAAATACTCACTAGATAATAACGCAAGA
TTGGGCAATTTAAGAGATTAGACAACCAATTTCAAGAAAGAGGTTGAAAATAGGTTCAAC
GAAGATCATTATAAGCTTACTTTATGCGCTACTACCTCTGATTTGGAGAGAATTAAGCAA
AGTCTGGATAGGTTTAGCACAGTCACTGAGTTTAACACTCTCAAAAATGATGTCTTGCCA
GTAATAAGAAGTTTTAAGTTAGATATAGATGGTTTTAAAGAGTCAAATGAATAAATCAAA
GAAATGATAAGAAGGTTTGATGAGGTACTCAGTGAAAAAGCTTCTAAAGTGTCTATTTTA
GAATTTGAACATTAAATTGAAAAAGAATATGTTAGGAAGAAGTATTGGGATTAGCTTTAA
GATGAAATAAAAACTACAATACAGCATCAACAAGATGTAGTTGTGGTTATGCAAAAAAAT
GTGAATAACTTTGAAGGACAAATGGGAGAAAAAATAGAAGAAACAGTTAAAAAGTCACTT
TAAAAAACTATGCAAAATTATGAGAGAGTTCTGAATGCATTCCAAAAGTTCTTTGACTAA
GAAGAACTTCAAAAGATTTTAGATAACAAAGCCAATCTAGATATGATTCAAAATTTGAAT
GATGCAAAAGCAAGCAAATTATAAGTGCTGTAAATAAATTAAATGATTGAGTAGTTGCTT
GAGAGAATTAAATAACTTTCCATTCTTCAAGTAGAAACTGCAAGGACACTTATACCTTAG
AAAAATCAAGGTAACGGATTTGAAAAGACTGAAAACTTGAATAGTAAAATATCAAAGAGA
GAGTATTTGTTGAAACTAACCTAACTCACAGCTTAATGGGTAGATGAATTTGACATGCAG
AAAAATGATGTTGATAATATTTACCAACTTTAAAGAATGAAAACTAGTTAAATGAGTACA
AGAAGAAGGTTTAGCAATGACGCCATGGATTAGTCTCCTTAAAATTTCACAACAAGCATA
CAATAGATTAAGAAGATTTATAAGTAGATGGCAGAAACATATAAACAAGATTTGCCGATA
AATATGTAAATTTTCAGAAAAAATTCAGTTAATCGGAATATTAATACAAAGAACTTTGGT
TTGAGAAAGAACACTTATTAACTTTCAGAGACTAATGATTTCAATCTAAGAGAGCAAGCT
TTAAATATAAATCAGAGTATCGAACAAAATCAAAAATGTAATGAGATTGGCATATTTGGA
AACAGGAAAAGTATTCAAGACAATAATCGAAGAAGCCACTTTTCTTCAACTTTAAGCATG
AATAACACCTCTCCTAACGAGTCTAAAAATGATTAGTAAAACAGAATAATACACACAAGT
GTGGGTAATCGGAATTATCATCATATCTACGTGGGCGATAATTAGTTTAATATATCAAAT
ACTGGATCTGGAGTAGCCTCCCCACATAATATTTCTCCTTCAAAAATAAGTCTCAGAAAT
GGCAGCTCTAACACTTTCATTTAATAGGAAAATGCCAATGACCCTTCAAACCAAAAGTTA
ACTTTTAACAAAAGCATTAGAAATAATATTTCGCCTATAAGTAATGATAAGCACTATCTT
TAAAGCTAAAAATTGTAGAATACCCTTATAGATTAAGATAAAATGCTTTTGATAAAAAAA
CAAGGAAGAAAGCTTGACATTAATAATTTAGTTGGAAAATTTAACTCATAAGATAAAGGG
GATAGAATTAGGCATAGAGTCTTTTATTAGACACCCAATAAGTAAAAAGAACTTTTTATT
TCTAATCCAAATGTTTGA


>Contig9.0.g67(protein)
MKEAFTHEAQMKELNQRKELDEFKSQVYYELEQATDFLMIKDLYKKGYTKIEEWISKINS
DIINISKQHTNQTSNELQGQYDNKIDIINKEFLILKTQIELMKDMRYQISQVSQKLDEKA
TYQNLRNLEYQMNDYVKIQTLKVVEQDIKEKVDQEVFNSLKDEFRLAQGNIQMLMKINKV
HEETQHQMDHSLKDSLHQLEKKLTNVEYDFKKYSLDNNARLGNLRDQTTNFKKEVENRFN
EDHYKLTLCATTSDLERIKQSLDRFSTVTEFNTLKNDVLPVIRSFKLDIDGFKESNEQIK
EMIRRFDEVLSEKASKVSILEFEHQIEKEYVRKKYWDQLQDEIKTTIQHQQDVVVVMQKN
VNNFEGQMGEKIEETVKKSLQKTMQNYERVLNAFQKFFDQEELQKILDNKANLDMIQNLN
DAKASKLQVLQINQMIEQLLERIKQLSILQVETARTLIPQKNQGNGFEKTENLNSKISKR
EYLLKLTQLTAQWVDEFDMQKNDVDNIYQLQRMKTSQMSTRRRFSNDAMDQSPQNFTTSI
QQIKKIYKQMAETYKQDLPINMQIFRKNSVNRNINTKNFGLRKNTYQLSETNDFNLREQA
LNINQSIEQNQKCNEIGIFGNRKSIQDNNRRSHFSSTLSMNNTSPNESKNDQQNRIIHTS
VGNRNYHHIYVGDNQFNISNTGSGVASPHNISPSKISLRNGSSNTFIQQENANDPSNQKL
TFNKSIRNNISPISNDKHYLQSQKLQNTLIDQDKMLLIKKQGRKLDINNLVGKFNSQDKG
DRIRHRVFYQTPNKQKELFISNPNV