Identifiers and Description

Gene Model Identifier

Contig12531.0.g31

Standard Name

SAMHD1e

Aliases

Contig12531_0_g31

Description

Protein of unknown function (DUF3895)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam13034 ) Protein of unknown function (DUF3895)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004200101.0002546821282671e-50HD domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12531.0.g31(coding)
ATGATACAATAAACCCAAGACGAAGAGCTAAAGTTAAACACAGATCCCAACTTGCTTTTC
TGGAAGAAGAGATACGTTCACGATAACGTCCATTAATTTCTCGAATTTCCTGAGTATTAT
TGGCAGTTTATTGATACACCCTAGTTTCAAAGACTCAGAGATATTAGACAACTTGGTTCG
GCTTATTTAGTATTCCCAGGAGCAGTTCACACTAGATTCTCCCATGCTTTAGGCATCGGT
CATTTGACTGATCAGATTATCACTTCAGTATTTGATGAGAGTAAGATCAGGTTAAAGCAT
AATATGAATTCAACTGCGTCTAATTCACAAAATGATCAAAGTTAAGAAAGCCTTGAGTAG
GATAAGAGAAACGTCATTTTGGCTGGATTGATGTCATAATTAGGCCAAGGAATGTATTCC
AATTTCTTCTAAAATCATATAATCCCCTTTTTAAAAGAGTAGCATGGATTAATCTGGGAT
ATCAAAGCACAGAATCAAAAGATTTTTGAGTATTTAATTGATGACAATCATATCGATATT
CATTAAGATGATTTTGATACAGTTTCTAAAATTCTTCTCCAAGATGGCATATAAAACAAC
AAATGTTTCTCTCAAGATAAAGCATGGATGTACTCAATCGTTAGCAACAATCACACATTC
TTGGATGCCACAAATCTTGACTAACTGAAGCGAGATTCAATAAGTCTAAACCTAAAATGC
GATAACTTCGATTCAGAGCGAATCATAAAGCATGCAAGACTCGTGGATAATGGGCAGTTA
TCTTTTGACACTAAACTTAAACATGACCTTCGAAAAGTTTATGAATGCAAGTATCAACTC
TCTAAAGATGTTTATACTCATCGTGTATGCACATCTCTTGACTATATGCATAGAGATGTT
TTGATTTCTGCAAATTAAGTATTCAAGTTTCACGAAATGATCCAAGTGCCTGAATAATTC
ATGAAACTCACTGACCCTTTGTTCAATTACATAGAGATTCACAAAAATCCTTTGCTGAGA
GAGGCTTAAGAGATTATGCGAAGAATCAGACAAAGAGATCTGTACAGGTTGGTAGGGTAG
ATTCTTGTTGACGATGAAAGAATGATTAAGGAGTTTAATGCTTAAAACCTTGTCAATTTT
CAAAAAGTGGGATTATTTGATCAAGAGATATTTTAGGAGGATATTGTCATAGATGTTTAG
ACTTTGAAATTAGGTGATGGAATTACAGATCCATTAAAACTAATAAACTTCCATTAGCAG
CAAGATTTGATAGGAGATGATATTCATGATGGAAGATCAAGGATTTGTTACCCTAGTATT
TTCTAAGAACATTACATTAGAGTTTTTGTTAAGGACGAAGAGAAATTCGATGCAGTGAAA
CATGCTTTCCATAGACTTTGCTAGTAATTCAGAGATAAAATAGGTGCCCAGCTCACACCA
GATCGACAAAGGCAATATTCCTCATAGAAACGGTACAGCAGCAATCAGGCCAGTAGAGCG
AATTCCCAGAGAGTGTCTTCAGCTTCAAATATGGATTCAGGAACATCTCCAAAGGGCAGA
GACTTCATAGGGAAGTATAGTTAGGATGTTAGTGCTTGGGTAGAATAGCTTGAAGATTTG
TGCACTCCTTAGAAGAAAAGGATTAGATATGATTGA


>Contig12531.0.g31(protein)
MIQQTQDEELKLNTDPNLLFWKKRYVHDNVHQFLEFPEYYWQFIDTPQFQRLRDIRQLGS
AYLVFPGAVHTRFSHALGIGHLTDQIITSVFDESKIRLKHNMNSTASNSQNDQSQESLEQ
DKRNVILAGLMSQLGQGMYSNFFQNHIIPFLKEQHGLIWDIKAQNQKIFEYLIDDNHIDI
HQDDFDTVSKILLQDGIQNNKCFSQDKAWMYSIVSNNHTFLDATNLDQLKRDSISLNLKC
DNFDSERIIKHARLVDNGQLSFDTKLKHDLRKVYECKYQLSKDVYTHRVCTSLDYMHRDV
LISANQVFKFHEMIQVPEQFMKLTDPLFNYIEIHKNPLLREAQEIMRRIRQRDLYRLVGQ
ILVDDERMIKEFNAQNLVNFQKVGLFDQEIFQEDIVIDVQTLKLGDGITDPLKLINFHQQ
QDLIGDDIHDGRSRICYPSIFQEHYIRVFVKDEEKFDAVKHAFHRLCQQFRDKIGAQLTP
DRQRQYSSQKRYSSNQASRANSQRVSSASNMDSGTSPKGRDFIGKYSQDVSAWVEQLEDL
CTPQKKRIRYD