Identifiers and Description

Gene Model Identifier

Contig14765.0.g89

Standard Name

SAMHD1d

Aliases

Contig14765_0_g89

Description

HD domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004200101.9999590304423412e-72HD domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14765.0.g89(coding)
ATGGAATTGCAGGAATTTTATTGGGAATTCATTGACACACCCGAGTTCAAGAGATTGCAT
GATATTAAACAACTCGGCACACTCTACTATGTGTTCCCTGGAGCTACGCATAGTAGATTC
TCGCATTCCTTGGGTATATATCATTAAATAATTTTATTCTAAATCCATTTGAATCTCATA
ATGCATCTTTCCCTTAAGACTATTAACATTTTCGATATTACAGGGACAGCCTACCTAGCC
CATGAGACCATGAAGCATTTCCGAGACGTAGCCCAAGAAGATTCGAAGTATCACAAAGTG
TACAATACATTTTAGGAAGCCGCACTGGCCATTGAGGATAGAGATATCTAAAATGTGGGA
CTCGCAGGGCTCATGCACGATCTCGGCCACGGTATCTACTCACATCTATTCGACAGGGAT
CTCATGCCCACTATCCTCAAAGCGCATGGTATTAAATGGGAACATGAGGATGCATCTGTG
ATGATGTTGGAGCATTTGGTAGATTAAAATCACATTGACATAGAAAAGGAAGATTTGAAT
TTTGTATAGAGACTTATCAAGGGAGACATTCCTCAAGCTGACCACCCCAAAAGGTGGATG
TTTGATATTGTTGCTAACAAAACGAATAGTCTGGATGTTGATAAATTTGATTATTTGTAG
AGGGATAGTAAGCACATGGGTATTAAAACAGTCGGCTTTGACTACAATAGAATTATCAAG
AATTCAAGAGTTGTGAATGGGCAAATATGCTATAATCAAAAGATCTATTTTGAATTCTCC
TAGGTGTTTCACACAAGATACAAGCTTTTCAAGGATACCTACACTCACAGAGTGTGCAAG
GCTATTGATTATATGATAGTTGACGCACTGTTACTCGCAAATCCAGTCTTCAAATTCTAA
GAAAAAATCTTTAACCCAAATGCCTACACTTACTTAACTGACAGCTTGTTAACACATATT
GAATTTAGTAAAAAGCCAGAGTTATAAGAATCAAAAGAGATTTTACTTAGATTGAGAAAT
AGGGATCTCTATAGGTTTATCGATTAAAAGTTATTAACTTCAAAAGAATTTGGTAAAAGA
ATAACATCGCAAGAGATTGTAAATTACTAAGATGTGGGGAAATTCGGAGTAAATCTTAGA
GCTGAAGATATCATTGTCTCTTTCCATAGCTTAAATTGGGGCAAGGGCAATGATAATCCA
CTTAATGCAGTGAAGTTTTACAAATAAGGTGAAAATGAAATAGAGACTTTTTACAAACAG
AGACAAGAAGTGGGATTATGCTATCCAAAGAATTATGAGGAGCACTATCTACGTGTTTTC
GTGAAAAACGAAGATAAGTTTGAGGCTGCAAAGTACGCTTTTCACAATATGTGCACAAGA
CACAAGGAAGAGATGGGTGAATTGCCTATGAGTCCTGAGAGGTCAAGATAATACTCTTCT
TAGAGGCGTTTAAGTCAAGAAAACAATCGCAGTTTATATAGTTAAAATTCTACTGCTCAG
AAAAGAGAGAGCTCTGTACAAATTGAGAACTTAGAGCAGAAGTTGCTTTAATCACAGGAT
CTATGGGATCACGAGAACGGTAATGGAAATGGATTGTCTTAAAATAGCATTAACAAAAGA
CTTAAATTCGACGCTAATGGAAATAATTGA


>Contig14765.0.g89(protein)
MELQEFYWEFIDTPEFKRLHDIKQLGTLYYVFPGATHSRFSHSLGIYHQIILFQIHLNLI
MHLSLKTINIFDITGTAYLAHETMKHFRDVAQEDSKYHKVYNTFQEAALAIEDRDIQNVG
LAGLMHDLGHGIYSHLFDRDLMPTILKAHGIKWEHEDASVMMLEHLVDQNHIDIEKEDLN
FVQRLIKGDIPQADHPKRWMFDIVANKTNSLDVDKFDYLQRDSKHMGIKTVGFDYNRIIK
NSRVVNGQICYNQKIYFEFSQVFHTRYKLFKDTYTHRVCKAIDYMIVDALLLANPVFKFQ
EKIFNPNAYTYLTDSLLTHIEFSKKPELQESKEILLRLRNRDLYRFIDQKLLTSKEFGKR
ITSQEIVNYQDVGKFGVNLRAEDIIVSFHSLNWGKGNDNPLNAVKFYKQGENEIETFYKQ
RQEVGLCYPKNYEEHYLRVFVKNEDKFEAAKYAFHNMCTRHKEEMGELPMSPERSRQYSS
QRRLSQENNRSLYSQNSTAQKRESSVQIENLEQKLLQSQDLWDHENGNGNGLSQNSINKR
LKFDANGNN