Identifiers and Description

Gene Model Identifier

Contig10619.0.g43

Standard Name

SAMHD1c

Aliases

Contig10619_0_g43

Description

Apoptosis antagonizing transcription factor

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

  • ( pfam13339 ) Apoptosis antagonizing transcription factor
  • ( pfam08164 ) Apoptosis-antagonizing transcription factor, C-terminal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006002508.999890565246037e-26hypothetical protein
SGDYDR299W0.00000039992052383199455BFR2 SGDID:S000002707, Chr IV
from 1059627-1061231, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10619.0.g43(coding)
ATGGAGGACCCAGAGGATTTATACAATCATTCTAAGTAATTCTATAAGTCAACCGAAGCA
GCCAAGGATTACGATCATCAAGTTGAAATTGGAGAGAGGAAAATCAAGGGAGACCCAGCA
ATGATGATGAATGACCTTGATCATTTGGTATATGGAGGAAAGAAAACATCTAGAGCTAAG
ATGCAACAAGCTGAGGATGATGATAGTGAAGATGATAATAATGACATGGATATTGATGAA
GATGAAGATGAGGACATTGACTCTGATGAATATGGCCAAGATGTAAACAGTGATGATGTA
GGAGAAGAGTAAGAAGATGATGATGATAGCAATGTAGAAGAGAGTGAAGTTGATGAAGAT
GATGATGATATTGAAGAGCAAATCGTAACTAAAGCATCAACTAAAAAGCAATAAATACCT
GCAAAAAACAAGCAAACACCTTAAATTTAAAATCAAGACCAAGACAATCTCGATATGGCT
CTCAATCAACTAAAACAAGAAGAGAAAGAAGACTCTAAATACATCTAAAAGCGTATGTCC
TCAGACATCTAAAAGGCTAAATCCGTGAAAACCCAGAAGAAAATCTTTGATTAGTTCCTT
CATCAGAGAATTTTGATGCAAAAACTGCTTCAGCACGGTAATATGCTACCAACCGCAGAC
ATGCTGGAGTTGTTTGTTAAACACTCAAAAAGCACAGAAATTAATGCACTATCTTGCAAG
AGAAACATCAAGAGACACTTAAAAGACCAAATTAAACTACAGAAATAACTCTTCCATCTC
TCTGAAACTTCAATTAAGCTATAAGAGGTATAATCAACTAAGGATAACAGCGACAATGAA
GACATTTCAGCTGATAAATTGTTCAAAGTGATAGATGGAAACTTCCAAGAAATGATGCCA
TTTGTAGAAGAGACCATTGATAGATGGAACAATCGCACAATGATGATAAAAAACTTAGGT
GGCAATCAATCTAAAAGCAAGGCCTTTGGAAAGACCATCTTGGAGCAGGTGAATTCTATA
TTTAATGAGTAAGACTCTAGACAGAAACTGAGAGAGAAATCTAACCTAAAACGTGATCAC
TATAGAATCCTGGGTAGAAAAGCTGATGATTTAGCTAATGAGAAAGACCCCAATATCTTT
AATGATTTTGATTTCTACTAAGTTCTGCTTAAAGACTTCTTGGCCAATGCTGACGGTAGT
GGTGCTGATGGCGATGACAAGTATAACGCCACTGGAGGTGGAGATGATGACATGTACTTG
GATGGTGCTGACTTAGGCTTAACTCAAAAATATTTAGAGAGAAAGAGAAAACTCCAGATG
AACAAAGGCGAGAAGATGAAGAAAGACGTTGATAGAAAAGCCTCAAAGAACAGAAAGATC
AGGTACATCGTTCATGAGAAGATTGTCAATTTCATGACACCCCATGACAACAATAACATC
GATGGTATTTATGACGGTAGAGATAGTGTTTTACTAAGTTTATTCGGATAAAATGCCAAT
AACAATCTTCAAAATGGAGATGGGACTGCCAATCAAAATGGAGGCAAAAAATCAAAGAAA
CAATAGAAAAACGAGATAGAAGAAGGCGGCATAAAACTTATCTGA


>Contig10619.0.g43(protein)
MEDPEDLYNHSKQFYKSTEAAKDYDHQVEIGERKIKGDPAMMMNDLDHLVYGGKKTSRAK
MQQAEDDDSEDDNNDMDIDEDEDEDIDSDEYGQDVNSDDVGEEQEDDDDSNVEESEVDED
DDDIEEQIVTKASTKKQQIPAKNKQTPQIQNQDQDNLDMALNQLKQEEKEDSKYIQKRMS
SDIQKAKSVKTQKKIFDQFLHQRILMQKLLQHGNMLPTADMLELFVKHSKSTEINALSCK
RNIKRHLKDQIKLQKQLFHLSETSIKLQEVQSTKDNSDNEDISADKLFKVIDGNFQEMMP
FVEETIDRWNNRTMMIKNLGGNQSKSKAFGKTILEQVNSIFNEQDSRQKLREKSNLKRDH
YRILGRKADDLANEKDPNIFNDFDFYQVLLKDFLANADGSGADGDDKYNATGGGDDDMYL
DGADLGLTQKYLERKRKLQMNKGEKMKKDVDRKASKNRKIRYIVHEKIVNFMTPHDNNNI
DGIYDGRDSVLLSLFGQNANNNLQNGDGTANQNGGKKSKKQQKNEIEEGGIKLI