Identifiers and Description

Gene Model Identifier

Contig1360.0.g112

Standard Name

SAMHD1b

Aliases

Contig1360_0_g112

Description

HD domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004200101.000296925633081e-74HD domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1360.0.g112(coding)
ATGGAAATTTAAAAATCTTAAAATTCACAATAGTAGCAAAACGGGGGAAACTTCAAAGTC
CCCATATATACGGCCTCGCAACAAAGTCAAGATATTGTTCAGCTGAGAGTAGACCCATCA
GATTCATTCTGGAAGAAGCGTTATGTATAGGACATGGTCTATAAATAAATGGAATTGCAG
GAATTTTATTGGGAATTCATTGACACACCCGAGTTCAAGAGATTGCATGATATTAAACAA
CTCGGCACACTCTACTATGTATTCCCTGGAGCTACGCATAGTAGATTCTCGCATTCCTTG
GGGACAGCCTACCTAGCCCATGAGACCATGAAGCATTTCAGAGACGTAGCCCAAGAAGAT
TCGAAGTATCACAAAGTGTACAATACATTTTAGGAAGCCGCACTGGCCATTGAGGATCGA
GATATCTAAAACGTTGGACTCGCAGGACTCATGCACGATCTCGGCCACGGTATTTACTCT
CATCTATTCGACAGGGATCTCATGCCCACAATCCTCAAAACTCATGGTATTAAATGGGAA
CACGAAGATGCATCTGTAATGATGTTGGAACATTTGGTTGATCAAAATCACATTGATATT
GAGAAGGAAGATTTGAATTTTGTATAGAGACTTATAAAAGGAGACATTCCCCATGCTGAC
CACCCCAAAAGGTGGATGTTTGACATTGTAGCTAACAAAACGAATAGTCTGGATGTTGAC
AAATTTGATTACTTGTAGAGGGATAGTAAGCACATGGGTATTAAAACAGTCGGCTTTGAC
TACAATAGAATTATCAAGAATTCAAGAGTTGTGAATGGACAAATATGCTATAATCAAAAG
ATCTATTTTGAATTATCCTAGGTGTTTCACACAAGATACAAGCTTTTCAAGGATACCTAC
ACTCACAGAGTGTGCAAGGCCATAGATTATATGATAGTTGACGCACTCCTACTAGCAAAC
CCAGTCTTCAAATTCTAAGAAAAAATCTTTAACCCAAACGCCTACACTTACTTAACTGAC
AGCTTGTTAACACATATTGAATTTAGTAAAAAGCCAGAGTTATAAGAATCAAAAGAGATT
TTACTTAGATTGAGAAATAGGGATCTCTATAGGTTTATCGATTAAAAGTTATTAACTTCA
AAAGAATTTGGTAAAAGAATAACATCGCAAGAGATTGTAAATTACTAAGATGTGGGGAAA
TTCGGAGTAAATCTTAGAGCTGAAGATATCATTGTCTCTTTCCATAGCTTAAATTGGGGC
AAGGGCAATGATAATCCACTTAATGCAGTGAAGTTTTACAAATAAGGTGAAAATGAAATA
GAGACTTTTTACAAACAGAGACAAGAAGTGGGATTATGCTATCCAAAGAATTATGAGGAG
CACTATCTACGTTGTTTATCGAGAAAAAACGAAGATAAGTTTGAGGCTGCAAAGTACGCT
TTTCACAATATGTGCACAAGACACAAGGAAGAGATGGGTGAATTGCCTATGAGTCCTGAG
AGGTCAAGATAATACTCTTCTTAGAGGCGTTTAAGTCAAGAAAACAATCGCAGTTTATAT
AGTTAAAATTCTACTGCTCAGAAAAGAGAGAGCTCTGTACAAATTGAGAACTTAGAGCAG
AAGTTGCTTTAATCACAGGATCTATGGGATCACGAGAACGGTAATGGAAATGGATTGTCT
TAAAATAGCATTAACAAAAGACTTAAATTCGACGCTAATGGAAATAATTGA


>Contig1360.0.g112(protein)
MEIQKSQNSQQQQNGGNFKVPIYTASQQSQDIVQLRVDPSDSFWKKRYVQDMVYKQMELQ
EFYWEFIDTPEFKRLHDIKQLGTLYYVFPGATHSRFSHSLGTAYLAHETMKHFRDVAQED
SKYHKVYNTFQEAALAIEDRDIQNVGLAGLMHDLGHGIYSHLFDRDLMPTILKTHGIKWE
HEDASVMMLEHLVDQNHIDIEKEDLNFVQRLIKGDIPHADHPKRWMFDIVANKTNSLDVD
KFDYLQRDSKHMGIKTVGFDYNRIIKNSRVVNGQICYNQKIYFELSQVFHTRYKLFKDTY
THRVCKAIDYMIVDALLLANPVFKFQEKIFNPNAYTYLTDSLLTHIEFSKKPELQESKEI
LLRLRNRDLYRFIDQKLLTSKEFGKRITSQEIVNYQDVGKFGVNLRAEDIIVSFHSLNWG
KGNDNPLNAVKFYKQGENEIETFYKQRQEVGLCYPKNYEEHYLRCLSRKNEDKFEAAKYA
FHNMCTRHKEEMGELPMSPERSRQYSSQRRLSQENNRSLYSQNSTAQKRESSVQIENLEQ
KLLQSQDLWDHENGNGNGLSQNSINKRLKFDANGNN