Identifiers and Description

Gene Model Identifier

Contig585.1.g65

Standard Name

SAE3b

Aliases

Contig585_1_g65

Description

Swi5

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYHR079C-A 138.9

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig585.1.g65(coding)
ATGTCTTCACAAAGATTATCGCAGCAATCTGTCACTTAGAACTCAAAATTCAGCTAATAA
AACAACAACAAAAGCAGCAATGACTAGTTTGCAATTTTACATAAGAAAATAAGCGAGTTT
TTGGCTTTAAATTAGGGGTATTAGAGTTATGAAAGTATAGTCAAAGAGTTTCAATTCAAA
TATCCCACAGTCAGAAGTGATTTGGACTTCATGTTAGCTCAGTAACTTTTCTTGAAATTG
GAGAATCGCATCCCTCATTTAAACTTGACGAAAATTGAGCCTGATGAAAACAAAATTTAA
GCAGTAGACTTGAAACCCCAAAACACGGATGCAGATGATCCAAATTCAGTGACAGTGTAT
TTGTTAAGAAATAAACCAGTGGATGCATATAAGCGCACATACTACAGAGTGAAAATTGAC
AAGAGACCAAGTGTTTTAATCAATAAATCGTCTAGTGGAGATAGTCAGTAAAAGAACCAA
AATCCTTTTGATAAAGATGATATCGAAAAAAAAGTAATTCAGTAGATTGCAGAGAGTAAA
GATAGAAAACAAAACCCTCAGAAATACATCGATACTTTCATGTAACCACCGATTGAGGAC
GAAGAAACACTTGATACTTTCCTTGATGTGACCTCAAAGCACAATATTGAACCAATCACT
GCTTAAATAGAGGATCCATCTACAAACATAGAGAACTTGACAAACTGTCTTGATTCAAAC
AGCATCAGCATCACTCTTAATCAAGACGATAATCAAGATACAATCTTTTCAAACAACCCA
AATGATACAGCGACTACTCTACCTTCTATACTGTAGCAATCAGGCAAAGATGATACTGGA
TAGGAAATTGAAGAGGATGTAGCAGAAATCGATGGAATGACAATGACACAGCAAGTAAGA
GAGGACAAGGAGAAACTGGAGATTATCAAGCAACTGGTCAAGATGGAATTAGAGCAAGAG
CAGATGAAGCACAAGCTGAATAATGATCAGAGATACATCAATTTGCTCCATGAATATAAC
TATTTGAAGGATGCTTGCTTTTAACTCGTAGAGATAGTCGCAAATGTTGCCTAAGTCCCA
GTGAAAGAAATCTTCGAGCAGTACGATGTGAGAGATATAGAACTAGATAACCAACCAGAT
AAGAGTGATAAACAACCAGAGGTGAAACCTGTAGATAAAGAGTAGAAACCAATGATTAAA
GCTAAACCTCTGGTTATGAAGCCAAAACCACTGCTTTAAGTTAAAAATCCAATAATGGCA
AAGCCTGATAAATAAGCAGATAAGAGTGAAACAGTAGCAACTACTACCACTACAGCAGAC
GTGAAGAAACCAGCTGCAAAGACCAAAGGTAAAGCTACAAAGAAAGAAGCTGCAGTGAAT
GACAAGGATGCTGCACAGAGTAAAGGCAAGGAGGAAACCAAGGAAACTGATGATACTTCG
CAAACCAAGAAAGGCAGGAAGAAGAAGGAAAAGAAATGA


>Contig585.1.g65(protein)
MSSQRLSQQSVTQNSKFSQQNNNKSSNDQFAILHKKISEFLALNQGYQSYESIVKEFQFK
YPTVRSDLDFMLAQQLFLKLENRIPHLNLTKIEPDENKIQAVDLKPQNTDADDPNSVTVY
LLRNKPVDAYKRTYYRVKIDKRPSVLINKSSSGDSQQKNQNPFDKDDIEKKVIQQIAESK
DRKQNPQKYIDTFMQPPIEDEETLDTFLDVTSKHNIEPITAQIEDPSTNIENLTNCLDSN
SISITLNQDDNQDTIFSNNPNDTATTLPSILQQSGKDDTGQEIEEDVAEIDGMTMTQQVR
EDKEKLEIIKQLVKMELEQEQMKHKLNNDQRYINLLHEYNYLKDACFQLVEIVANVAQVP
VKEIFEQYDVRDIELDNQPDKSDKQPEVKPVDKEQKPMIKAKPLVMKPKPLLQVKNPIMA
KPDKQADKSETVATTTTTADVKKPAAKTKGKATKKEAAVNDKDAAQSKGKEETKETDDTS
QTKKGRKKKEKK