Identifiers and Description

Gene Model Identifier

Contig9812.0.g19

Standard Name

SAE3a

Aliases

Contig9812_0_g19

Description

Swi5

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYHR079C-A 138.9

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9812.0.g19(coding)
ATGTCTTCACAAAGATTATCGCAACAATCTCACAATTAAAACTCAAAATTCAGCCAATAA
AACAACAGCAAAAGCAGCAATGATTAATTTGCAGTTTTATAGAAGAAAATAAGTGAATAT
TTGGCTTTGAATCAGGGGTATTAGAGTTATGAAAGTATAGTTAAGGAGTTTCAGTTCAAA
TATCCCACAGTCAGGAGTGATTTGGACTAAATGTTAGCTCAGCAACTTTTCTTGAAGTTG
GAGAATCGTATCCCTCATGTTAACTTGACAAAAAGTGAGCCAGATGAAAACAAAATTTAA
GCAGTAGACTTGAAACAACAAAACGCAGATGCAGATGACCCCAATTCAGTGACAGTGTAT
TTATTAAGAAATAAACCAATGGATGCTTATAAGCGCACTTACTACAAGGTGAAAATTGAC
AAGAGACCCAGTGTTTTAATCAATAAATCGTCAAATGGAGATGGTCAGCAATAGAACTAA
GATCCCTTCGATAAAGATGATATCGAGAAGAAAGTAATTCAGTAGATTGCTGAGAGTAGA
GATAGAAAATTAAACCCTCAGAAATACATTGATACTTTTATGTAACCAGCAATTGAAGAA
GAAACAATCGATACTTTTCTTGATGCGAAGCACAACATATAACCAATAACTGCTTAAATT
GAGGATTCCTCTACAAACATAGAAAACTTAACGAATTGTCTTGATTCAAACAGTATCAGC
ATCACTCTTAATCAAGACGATAATCTAGAAACTAACTCTTCAAGTAAATTAATTGATACT
ACTCTACCTTCTATACTACTGCAATAGCCTGATAAAACAGATGCCTTATAGGAAATTTAA
GAAGAGGATGTGGCAGAAATCGATGGAATCACAATGACACAGCAAACAAGAGAGGACAAG
CAGAAACTGGAAATCATCTAGCAATTTGTTAAGATGGAACAGGAACAAGACCAGATGAAG
CACAAATTGAATAATGATCAGAGATACATCAATTTGCTTCATGAATACAATTATTTGAAG
GATGCTTGCTTCTAACTCGTAGAAATAGTAGCAAACGTTGCTTAGGTTCCAGTGAAGGAA
ATTTTTGAGCAGTATGACGTGAGAGATATTGAACTCGATAACCAGCCAGAGAAGAGTGAA
AAACAATCAGAAGTCATCCCTGCAGTAAAAGAGTAGAAACCAGTGATCAAAGCTAAACCT
CTGGTTATGAAGCCAAAACCACTGCTATAAGTTAAAAATCCAATAATGGCAAAGCCTGAT
AAATAAGCAGATAAGAGTGAAACAGTAGCAACTCCTACTACTACAGCTGACGTGAAGAAA
CCAGCTGCTAAGACCAAAGGTAAAGCTACTAAGAAAGAAGCTGCATTGAATGACAAGGAT
GCTGCACAGAGTAAAGGCAAGGAGGAAACCAAGGAAACTGATGATACTGCGCAAACAAAG
AAGGGCAGAAAGAAGAAGGAAAAGAAATGA


>Contig9812.0.g19(protein)
MSSQRLSQQSHNQNSKFSQQNNSKSSNDQFAVLQKKISEYLALNQGYQSYESIVKEFQFK
YPTVRSDLDQMLAQQLFLKLENRIPHVNLTKSEPDENKIQAVDLKQQNADADDPNSVTVY
LLRNKPMDAYKRTYYKVKIDKRPSVLINKSSNGDGQQQNQDPFDKDDIEKKVIQQIAESR
DRKLNPQKYIDTFMQPAIEEETIDTFLDAKHNIQPITAQIEDSSTNIENLTNCLDSNSIS
ITLNQDDNLETNSSSKLIDTTLPSILLQQPDKTDALQEIQEEDVAEIDGITMTQQTREDK
QKLEIIQQFVKMEQEQDQMKHKLNNDQRYINLLHEYNYLKDACFQLVEIVANVAQVPVKE
IFEQYDVRDIELDNQPEKSEKQSEVIPAVKEQKPVIKAKPLVMKPKPLLQVKNPIMAKPD
KQADKSETVATPTTTADVKKPAAKTKGKATKKEAALNDKDAAQSKGKEETKETDDTAQTK
KGRKKKEKK