Identifiers and Description

Gene Model Identifier

Contig3896.0.g74

Standard Name

RXT3

Aliases

Contig3896_0_g74

Description

Histone deacetylation protein Rxt3

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009928306.997125142158947e-47hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3896.0.g74(coding)
ATGAGGGAGGAAGCTGATAAATCAGAATTAAACGATAATGGAAATGGTGATGGCAATAAC
AATGGAGATAATTATAAGGATGGTGCAGCTGATGATAATCAAGGTTCAGATGATAAGGAA
ATGGCTGATCAAGATAATGAATCAGATGATGAAGATGATGATAACAAAAGTCAATTAAAT
GCAGCAGGTTAGGAGAGGCAAGCTTTAGGGACCACGACAAGAAGTGGCAATGCAGGTGTA
ACAACTACGACAACTACTGCAGTCAAGAAGACTCTGCAAAAGCCAAAGAAAAATACTGGT
AATGCTGGCGGTGTCCGAAGGAAGCAACAGAACCAAGATGACTATGGCAATGACCACAGC
AACTTTGACTCAGGATATACAGCGGCACCATTGAAAAGTATAGGTTATGTGCGCCAGAGG
TTCCTCTATAAACCCTTCATGCCCCTGCCAGACCTTCATGAATACATTGGCGAGCTCATA
GAGTTCAGAATATACTCATCCTACCTCACCAAGTTCAATAAAGCGTACATTCATCGCAAT
TTCTATGGCACTGATATCTATACAAGTGATTCAGACCCTGTTTGTATTCTGTAGCATGTA
GGATTTTACAAAGTTACTGATGAGGAACCATAAGATTACGAGGGAATCTCAGTATATTTC
AGAGTGGCAAAGGGTCGTAATAACTACACAGCTTCTTAAAAGTTTGGAATTAGAAGTAGA
AAAATGGGTTAATTTGACGGTCATAGTATTAAATATGAGGGAGCTGAGAGACTGATTAAA
TTTGGCTCAGAAAAGGATTTGATGCAGATGACTTACGTGATGCCCACTCATTTAGAGCCC
ATAGTCCTAAAACATCAAAGAAAAATGCAGTAAAAAAATAGAATCATTAGCTCTAGAATC
CCAGATACAGCTTATAAAGCCATAACTCCTACTATGGTCTTCAATTTATCCCTTGAGCCA
GCCTTTGAATTCACATTGTCTACTTTTGCAGATAAAGGAGATGACTTGTCAGGCAGGACA
TGCCAGAAACTTCAGGATAACGTGCTTTACATAGAAACTGAAAACAAAAGATTCGAAATA
TCAAAGCAAAATAATCAGGCAGGGGTTCCTATATCTGAGACTGGTATCAGATACAGATTT
GCAGAAGTTAGTGAACCTTTCTTGAAGGACTCAATCTTTATGCAGAGAGAAAGAAGACCA
CTAGAAGAGAGCCACATTTAAAAGACAATCGCAAAAGATTTGGACTGGTCTGAGTTTGTG
TGGGGTGAAAAATCACTTGAAGTCAATGGAGTCAGATACGAAAAGATTAAGAATTACAAA
TACTTCCCTGTCAACAAGTGA


>Contig3896.0.g74(protein)
MREEADKSELNDNGNGDGNNNGDNYKDGAADDNQGSDDKEMADQDNESDDEDDDNKSQLN
AAGQERQALGTTTRSGNAGVTTTTTTAVKKTLQKPKKNTGNAGGVRRKQQNQDDYGNDHS
NFDSGYTAAPLKSIGYVRQRFLYKPFMPLPDLHEYIGELIEFRIYSSYLTKFNKAYIHRN
FYGTDIYTSDSDPVCILQHVGFYKVTDEEPQDYEGISVYFRVAKGRNNYTASQKFGIRSR
KMGQFDGHSIKYEGAERLIKFGSEKDLMQMTYVMPTHLEPIVLKHQRKMQQKNRIISSRI
PDTAYKAITPTMVFNLSLEPAFEFTLSTFADKGDDLSGRTCQKLQDNVLYIETENKRFEI
SKQNNQAGVPISETGIRYRFAEVSEPFLKDSIFMQRERRPLEESHIQKTIAKDLDWSEFV
WGEKSLEVNGVRYEKIKNYKYFPVNK