Identifiers and Description

Gene Model Identifier

Contig13363.0.g11

Standard Name

RVB1b

Aliases

Contig13363_0_g11

Description

TIP49 C-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004768209.997093137033517e-262TIP49 C-terminus family protei
n
SGDYDR190C9.997093137033517e-262RVB1 SGDID:S000002598, Chr IV
from 841995-840604, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13363.0.g11(coding)
ATGAAAATTGAAGAAGTTAAATCTACCACTAAAACTCAGAGAATCGCCTCACATACACAT
ATTAAGGGTCTTGGACTCGCTGAAGATGGGACCCCAATTGAAATTTCACATGGTCTCTGT
GGATAAGAAAAGGCAAGAGAAGCTTGCGGTATTGTCGTAGACATGATTAGATCAAAGAAG
ATGGCAGGTAAGGCTCTTTTAATGGTTGGACCCCCAGGCACTGGTAAAACTGCTATGGCA
TTGGCTATCGCTGCTGAGCTTGGTCCAAAGGTTCCATTCTGCCCCATGGTTGGATCAGAG
GTGTACAGTTCAGAAGTTAAAAAAACCGAAATTCTTATGGAAAATTTCAGAAGAGCTATT
GGACTTAGAATTAAGGAAACCAAGGAGGTATGGGAAGGTGAAGTAACTGAGATTTCCCCA
GAGGAAGTTGAGGATCCTCATGGAGGCTATGGAAAAGTAGTTAGTTCAGTTATTGTAAGT
TTAAAGACTACTAAGGGACAAAAGCAGCTTAAGTTGGATCCTAGTATATACGAGAATATC
TAAAAGGAGAAAGTTGCAGTTGGTGATGTTATCTATATTGAAGCAACTAGCGGAGCTGTC
AAGAGAGTTGGTAGATCAGACGCTTATGCAACTGAATACGATCTTGAAGCTGAAGAATAT
GTTCCAATCCCAAAGGGTGATGTACACAAAAAGAAGGAAATCGTATAAGATGTTACTCTT
CATGATCTTGATGTTGCAAATGCAAGACCCCAAGGTGGACACGATTTCTTGTCTTTGATG
AGTTAAATTAACAGACCAAAGAAGACTGAAATTACAGAAAAGCTTCGACTTGAAATCAAC
AAGGTCGTTAACAAATATATTGATCACGGTATTGCTGAACTCGTTCCAGGAGTTCTCTTC
ATTGATGAGGTCCATATGCTTGATATCGAATGTTTCACTTATCTCAATAGAGCTTTGGAA
AGCAACCTTGCCCCAATTGTTATTTTGGCTACAAACAGAGGTCACTGTTAAATTAGAGGT
ATCGAAATGAAGGCACCACATGGTATTCCCGTCGATCTCTTAGATAGATTACTTATCATT
AGAACCCTACCCTACTCATTGAATGATATAGTACAAATCTTGGCTATCAGATGTGCTACA
GAGAGTATTGAAATTGAGGAAGAGGCTTTAGCTCATCTTGCCTCAATCGGTACAAGAACA
TCCTTGAGATTCGTTGTCTAACTTATTACTCCATCTTTCGTACTTGCGGGTACCTTAGGT
AAATCCAAGATCACTTTGGACGAAGTCAATGAAATCAGCACTCTTTTCTTCGATGGAAAA
TCATCAGCTAAGCTCCTTCAAGAACAAGCCAAGTACTATATTTCATGA


>Contig13363.0.g11(protein)
MKIEEVKSTTKTQRIASHTHIKGLGLAEDGTPIEISHGLCGQEKAREACGIVVDMIRSKK
MAGKALLMVGPPGTGKTAMALAIAAELGPKVPFCPMVGSEVYSSEVKKTEILMENFRRAI
GLRIKETKEVWEGEVTEISPEEVEDPHGGYGKVVSSVIVSLKTTKGQKQLKLDPSIYENI
QKEKVAVGDVIYIEATSGAVKRVGRSDAYATEYDLEAEEYVPIPKGDVHKKKEIVQDVTL
HDLDVANARPQGGHDFLSLMSQINRPKKTEITEKLRLEINKVVNKYIDHGIAELVPGVLF
IDEVHMLDIECFTYLNRALESNLAPIVILATNRGHCQIRGIEMKAPHGIPVDLLDRLLII
RTLPYSLNDIVQILAIRCATESIEIEEEALAHLASIGTRTSLRFVVQLITPSFVLAGTLG
KSKITLDEVNEISTLFFDGKSSAKLLQEQAKYYIS