Identifiers and Description

Gene Model Identifier

Contig14633.0.g90

Standard Name

RUVBL2

Aliases

Contig14633_0_g90

Description

TIP49 C-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000469209.997093137033517e-262TATA box-binding protein
SGDYPL235W9.997093137033517e-262RVB2 SGDID:S000006156, Chr XVI
from 103232-104647, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14633.0.g90(coding)
ATGACTACAACTGGTATTCACTCAAAAGTCCAAGAAGTTAAGGATCTCACTCGTATCGAA
AGAATCGGTGCTCACTCTCATATTAGAGGTCTCGGTCTTGATGATGCACTTGAACCCAGA
AAGATTTCATAGGGTATGGTCGGATAGTTGAGAGCAAGAAAGTCAGCTGGTATCATATTA
ACCATGATTAGAGAAGGAAAGATTGCAGGTAGAGCTATTTTAATTGGAGGTTAACCAGGT
ACTGGAAAGACCGCTATCGCGATGGGTATGGCCAAATCACTTGGAGAGGAAACTCCTTTC
ACTATGCTTGCAGGTTCCGAAATCTTCTCACTTGAAATGTCAAAGACTGAGGCACTAACA
TAAGCTTTCAGAAAATCTATTGGTGTAAGAATCAGAGAAGAGGCTGAAATCATTGAGGGT
GAAGTCGTTGAGATTGAAATCGATAAGTCAGTTTCATCAGGGGCTAAGACCGGCAAGATT
ACCTTGAAGACCACTGAAATGGAAACTGTGTATGACCTAGGACAAAAGATGATTGAGGCT
ATTCAAAAGGAGAAGATTGTAGCTGGAGATATTATTACTATTGACAAGGCATCAGGCAAA
ATCTCAAAGTTAGGAAGATCCTTCTCAAGAAGCAGTGATTACGATAATGTTGGTCCACAA
ACCAGATTCGTTCAATGCCCAGAGGGAGAGCTATAAAAGAGAAAGGAAGTTGTTCATACT
GTCACTCTTCATGAAATTGACGTTATTAATAGCAGAACTTAAGGTTTCTTGGCTCTATTC
GCAGGAGATATTGGAGAAATTAAGCAGGAAGTAAGAGAGCAGATTGATTAAAAAGTTGCT
GAATGGAGAGAAGAAGGCAGAGCTGAAATTGTTCCTGGTGTTCTTTTCCTCGACGAGGTT
CATATGCTTGATATCGAGTGTTTCTCCTTCCTTAACAGAGCATTGGAAAGTGATTAAGCC
CCAGTCGTTATCATGGCTACTAACAGAGGTATTACCAAGATTAGAGGAACTGACTACTTA
AGTCCCCATGGTCTTCCAATCGATCTCTTGGACAGAGCTTTGATCATTACCACAGATCCA
TACAACGAGAAAGAAATCTAACAAATTCTTGAAATCAGATGTCAAGAAGAAGACGTTGAA
ATTACAGAAGACGCTATGAAGCTCTTAACTAAGATTGGAAAAGAATCATCACTTAGATAC
GGTATCCACTTAATTACTGCCTCAAACCTGGTCTCAATTAAGAGAAAGTCCCATGAAGTC
GATGTATAAGATATCAGGAAGGTCTACTCACTGTTTGTGGATATTAAGAGAAGTGTGCAA
TTCTTAAAAGACTTTGAGAAAGAATTCATGTTCCATGAAGTCGCTGCAGACAACGGTGAA
GCCATGGACACTAGCTGA


>Contig14633.0.g90(protein)
MTTTGIHSKVQEVKDLTRIERIGAHSHIRGLGLDDALEPRKISQGMVGQLRARKSAGIIL
TMIREGKIAGRAILIGGQPGTGKTAIAMGMAKSLGEETPFTMLAGSEIFSLEMSKTEALT
QAFRKSIGVRIREEAEIIEGEVVEIEIDKSVSSGAKTGKITLKTTEMETVYDLGQKMIEA
IQKEKIVAGDIITIDKASGKISKLGRSFSRSSDYDNVGPQTRFVQCPEGELQKRKEVVHT
VTLHEIDVINSRTQGFLALFAGDIGEIKQEVREQIDQKVAEWREEGRAEIVPGVLFLDEV
HMLDIECFSFLNRALESDQAPVVIMATNRGITKIRGTDYLSPHGLPIDLLDRALIITTDP
YNEKEIQQILEIRCQEEDVEITEDAMKLLTKIGKESSLRYGIHLITASNLVSIKRKSHEV
DVQDIRKVYSLFVDIKRSVQFLKDFEKEFMFHEVAADNGEAMDTS