Identifiers and Description

Gene Model Identifier

Contig19748.0.g48

Standard Name

RUSA1

Aliases

Contig19748_0_g48

Description

Endodeoxyribonuclease RusA

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19748.0.g48(coding)
ATGTTTAACAAGCCTTAAGAGTCTGATAATAATCTAAAAGCTCCTAAGAATTATGAAGAA
AATCATGAGAAATATTTATAGCAGAAAAAGTCAAAAGGTATTTATGAAGAGATATTGGAC
CATTTACTTAAAACAAATATATTTACAGCTGAGGAATTGCAATAACAACTATTAGCTCCT
GAGAAACCTGACATCACTAACTTAGTCAAGAAGATGCTTCAAAGTGCAAAAGAAGGAAAA
TGCTACCATAATGATCAACTTTTACTGGGTGTTATAGTAAGAGGAATAAAAACTAAATCT
ATCAATTTTAATGATATAGCTTTGTGGCCCTTACTCACAGAGTACTTCATACCTTTAATG
GCCAAACAGGATAACTTATAAAGAGATCGAAGAAATTAAAAATATTTCCTTCAAAAATGT
TCTACGATTGCTTATTTAATTCATATTTGCCCACAACCTCAAACTTTGAACAAAAACTTA
GTGAAACTGGTTCTTGATTAAATGGAAAATATTGGGGAATTGTATTTTAATATAAATTAA
GTGGAACTAATGTACGTCCTCATGTTTGTTACAACTTGTGACAAAACTCTTAACATAAGT
TTGCCAGTTAAGGTGTTTGAAGCCTTATAAAAAAGAGTAATTTCTATGTGCAAAAGTTAG
AATTTACATGGAGTAACTGCTCTGAACCCATAAAATTTAAGTTTAATTGCAAATAAATTT
TCGCAATTTAAGCTTCAAGCATCACCATCATTCTGGCTGGTTTTGCAAAATGAGATTGAT
AAATCTTTCCCACTGTTTAACTTTATGGATTTCTCTCTGATTATCTAGGCGTATAGCAAA
ATGAATTTTCTGAACCCAGAGAAGTTCTTCTCATTCGTAACAAAAGCAATAAAGATATTC
TAGTATAAACAAGAATTTAAAATACAAGATTTCTCTTAAATACTTTCTGCCGCTAAGTAT
CAGAGAACCCCTATGGGTAATAGAACCTAATTTGAACTAGGGTTTTGGGATTTAATTGGA
GAAGAATTACCGAAATGTCTTTAGCAAAATGAAGATAACTTTAGCATGAATGACTTTATC
ATAATTGTTAGTTCGATTCATATGGACATGCCAAGAAAGATTTACAAAGATGTTTGGAGA
TCTCTTGATAAACATTTAGTAAGTTACACTAATGACTTAAAAATCATGCACCAAAATTCA
ATCAAAAGCTCTTTAATTTTACTAAGAGCATACTACGATCAAGATATATCTACATTAAAG
CCAGGTGTCTAAATACTGATTTAAAGCATTTTTGAAAAGATAGTTGAATATTGCATGGAA
AAGTAAAAAAATGCATCAATATTTACTTTACCAACGCATGACTTAGTTGTCCTAACTATG
CTCTGTAGTCATTATTAGTCTTAAGAATGTCTAGGATTTGCACTCTCCAAGTTAATAATG
TAAAAAGACAGCTTATCTTCTTTAGATAAGTCAGATTTAAGAAATACTTTAGAAAAACTA
AAAAGCTCTTCAACTATGGATTTAAGTATTTTCAGTACAGAACTGTAAGAATTAGAAAAC
ATTATTAATAACTGA


>Contig19748.0.g48(protein)
MFNKPQESDNNLKAPKNYEENHEKYLQQKKSKGIYEEILDHLLKTNIFTAEELQQQLLAP
EKPDITNLVKKMLQSAKEGKCYHNDQLLLGVIVRGIKTKSINFNDIALWPLLTEYFIPLM
AKQDNLQRDRRNQKYFLQKCSTIAYLIHICPQPQTLNKNLVKLVLDQMENIGELYFNINQ
VELMYVLMFVTTCDKTLNISLPVKVFEALQKRVISMCKSQNLHGVTALNPQNLSLIANKF
SQFKLQASPSFWLVLQNEIDKSFPLFNFMDFSLIIQAYSKMNFLNPEKFFSFVTKAIKIF
QYKQEFKIQDFSQILSAAKYQRTPMGNRTQFELGFWDLIGEELPKCLQQNEDNFSMNDFI
IIVSSIHMDMPRKIYKDVWRSLDKHLVSYTNDLKIMHQNSIKSSLILLRAYYDQDISTLK
PGVQILIQSIFEKIVEYCMEKQKNASIFTLPTHDLVVLTMLCSHYQSQECLGFALSKLIM
QKDSLSSLDKSDLRNTLEKLKSSSTMDLSIFSTELQELENIINN